CAZyme Information: KAE8538024.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8538024.1
• CAZy Family: AA6
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622	VHDQ01000014|CGC3	70300.61	5.6587

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=VHDQ01000014:1108660-1111628(-)

Full Sequence      

MPRYLRIYVAVAAFALLAAVHYTLHPFHRAPPSPFASSPSAGVFDGDDGQRTDSAGIVID
KKGLMSYSPGHAGHPVEMLIERGKKHAEDMERRIASVKSVKDSAKDYVLSFGMQPPRGFD
AWYAYTQSVPAPHPPPLPSLIPLVHEPMLPFLSHPAALLRTRVEELRDNDGSIFTLTFVP
DGQGDRGTACPANGKWHTKDWHVRDKGMVLVRGAAAWSWRCNNTLSLLLPLLPLMPEEMF
SQNPPLELAFSIDDGPRGMVHNTFRERSEALARSGRLWSEAQLHQAEQAMRWTYGWSWSC
PENTPLKGRGSDLVLNDLTDIVSADAESQDVAEDKTFIADFDKGIDYCMNPDLMNLHHIL
LSEQYRAAVNLVPALATCRTKWNSDLVGVPLDGVHETVEFIPWEKKEINKAFWRGTATGL
FHDKLNAWRQSQRERLHWFGNNMTGTVPLLLPDGSIKYWDRADLVDKWSDVGLSGGPTQC
NVEDGTCDVMAEEIDFKDRVSKEDGIKYKYVIDVDGNGWSSRFRRLLQGNNVVFKSTLYP
EWFHDMLIPWYHYVPTKLDYSDIFDILAFFQGSPDGSIPGRDDLAKEIAAHAHEFVQERW
REEDMRSFMYLLILEVSNASDL

Enzyme Prediction     

No EC number prediction in KAE8538024.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	369	617	1.3e-60	0.892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.74e-20	371	619	30	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.21e-12	496	618	205	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB74299.2|GT90	0.0	1	617	1	623
ADV20524.1|GT90	0.0	1	615	1	582
UOH81501.1|GT90	0.0	1	622	1	628
AUB22757.1|GT90	0.0	1	615	1	621
AFR93241.2|GT90	0.0	1	615	1	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.40e-10	504	617	233	339	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.14e-68	69	620	147	656	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q7ZVE6|PLGT2_DANRE	7.29e-11	363	597	241	443	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1
sp|G3V9D0|PGLT1_RAT	1.56e-10	504	617	261	367	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	8.61e-10	504	617	261	367	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.14e-09	504	617	261	367	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000008

TMHMM  Annotations     

Start	End
7	24