CAZyme Information: KAE8537769.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8537769.1
• CAZy Family: AA14
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		52348.22	4.8866

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=VHDQ01000014:403341-405024(-)

Full Sequence      

MFPLGAFITTTICLLSHLPTALAFGVQNYPNLFFDASAVVSNQWFNGVDSRWAREMSEHW
AQTLIHYGPWSVTNKSYTAKSGDKKDYLSWAVYHWPDCSNVQNTTELTQEEVWDECDYVV
RDGQLNPDIELVKDKQALQNMSNSVYLSAMAYLHTNDSQYTTHINHALHTFFINNDTRMN
PNLNYAQVIRGPGDQMGRHTGVLDLACLAKIVSGVQVMRSIKPAEWQQETETGIMQWASE
QLNWLYTSEQGLGELNATNNHGTFAVNQVCALNVLLNQNDACVTALEDFYNGIYLDQIAS
NGDQPLESGRTRPYHYRAFNLMALVTNAQFGDFVGLSPSAWERRSAANATIVDALHFAML
QNYTASNELNQGRALNPVVAAISAKYGDPDNKYANFLKSSDPYFPGQPWFALNEGLSDAG
IKQGLLETTYGPVPSQPTPGAGSPDDPNYQRKRNWESRGTGWPTAAPTAP

Enzyme Prediction     

No EC number prediction in KAE8537769.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	72	359	3.1e-88	0.96415770609319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	8.57e-74	71	359	1	265	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV20174.1|PL38	0.0	1	470	1	470
KGB74556.1|PL38	0.0	1	470	1	470
AAW40805.1|PL38	1.97e-310	1	470	3	472
AFR92301.1|PL38	2.98e-305	1	470	3	472
AUB21714.1|PL38	2.98e-305	1	470	3	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	7.09e-27	61	357	37	316	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

KAE8537769.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.035544	0.964437	CS pos: 23-24. Pr: 0.9239

TMHMM  Annotations     

There is no transmembrane helices in KAE8537769.1.