CAZyme Information: KAE8537620.1

Basic Information

• Species: Cryptococcus cf. gattii
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus cf. gattii
• CAZyme ID: KAE8537620.1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	VHDQ01000015|CGC1	86361.77	5.1399

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccf.gattiiMF34	6321	N/A	114	6207

• Gene Location: location=VHDQ01000015:294000-296963(-)

Full Sequence      

MPKNFDIESIVDQLTLEEACALTHGQDFWRLNGVPRLGVPAGLKVTDGPNGARGEDFVGG
CTSALFPAGCSLGASFDVGSAIKIGEALARECRAKSAVALLGPTVNIHRHPAGGRNFESY
SEDPYLSGVMASGYIQGLQEAGITSVTKHFVCNDSETDRRTVDVIVGEQALREIYLRPFQ
IAFERAGPRGVMTSYNKASYPGNHPQFTQRLLESVVRGEWGVEDLTVMSDWWGTYSVGPA
IVAGMDLEMPDSFHRGNGKLLAAAQDDENLAKAVFDRARNVLRMIKRAGGYSLEPERPEA
AEDLPETRQLIREVGAEGMTLLKNTGVLPLSPKTKTVVAGTYATVALAHGGGSASLDAHR
KITPAEGLHEAMDEIVVVPGPVPYLYLPLPQPDVFSSSGGAGTCKVDFYNPGGKLVDSLA
GWTAKMSFKLSPKTTGTHALTVASPSSAKLSINGQYLAFHKCSVNTTYTFEAGKEYDIVI
NYVSTEELFYSTACALNGIRFGYLEYTDDDAAIQSAVKVAEEVGTVLVCVGHGSDYETEG
FDRDDIFLLGKQNAFVQALADSSAKVIVVVFAGSPIAMPWLDAVEAVVYGWFPGQELGHS
LADILIGKINPSGRLPVTFPKAIEDSPAFDNFPGVNEIIKYEEGVFVGYRHYSSRQIPTL
YPFGFGLSYTNFKVTDMALRGAESFGPGKKIEISVKITNTGSIAGRHTVLLFAQPPAAED
RPILSLVDFVKSSELKPQESQTLTMTIGGEALSVWEGSEAGSWVVKEGKYSLQIRDNAEA
RPMQSAELRIGQGWKWHGLHA

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	250	1e-53	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.59e-55	66	774	120	750	beta-glucosidase BglX.
224389	BglX	7.94e-50	26	376	47	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.62e-45	319	669	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.09e-32	9	776	55	770	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.69e-26	36	284	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB26217.1|GH3	0.0	108	801	3	728
AFR96312.2|GH3	0.0	108	801	3	728
KGB75246.2|GH3	0.0	1	633	1	623
KGB80091.3|GH3	1.53e-232	1	364	1	362
ABQ91838.1|GH3	1.34e-169	7	779	16	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.78e-125	5	799	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.71e-120	5	799	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.06e-108	6	774	4	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	6.40e-89	7	774	4	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	8.99e-88	7	774	4	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.81e-163	7	774	11	823	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	7.20e-162	7	778	2	799	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	4.64e-155	7	799	14	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	3.74e-150	7	799	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	3.74e-150	7	799	14	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.981642	0.018355

TMHMM  Annotations     

There is no transmembrane helices in KAE8537620.1.