CAZyme Information: KAB8212079.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8212079.1
• CAZy Family: GT58
• CAZyme Description: luciferase-like domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
879		96258.44	4.6221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734937:829404-833192(+)

Full Sequence      

MRYHIVYALTAAASLSVAADIYVSPSGSDTAAGTIDAPLLSIQSAVDKATAGSTIYLREG
TYSPTTNIQITKSGTSSAPYVLRAYDGEKVTIDGEELPGTPAELDASLANEDRGILHIQD
AEYWEFYDLELINGPYGVYARDSSNNHYERIITRENYETGFQLEGASSNNSVYYLDSYLN
RDPRKNGESADGFACKEGSGEGNVLRGARLWNNVDDGLDLWEFKSAVTIEDTISYGNGYN
RWDFSPFEGDGNGYKLGGGDDADIGPANHVITNCIAFGNSKDGFTDNSQPGDFTLTRNTA
WNNAKVGFKFNTAVATLSKNIAAENGESPTSLSEEQVSTGNSWDGSESWGNSSFVSVDAT
LVQGARKADGTIDPSDFLLPKSGEEIGATTACANMTKTSEKKPWILNAFAMFSPGHLSPG
LWKHPQDRAGDFLDLSYWIELAKVLEKGRFHGLFLADHLGIYDVYKGPGNREPALLSGAQ
FPIGDPFLLISAMASVTTSLSFGITASTTYETSPYALARKFSTLDHLTHGRVGWNIVTSF
LDSAAKAYGMDEQIPHDERYARADEYMELTYKLWEGTWRDGAVVKDPNTGVYSDPSQVRA
IEHQGKYFKSTAASQLPASKQRTPLLFQAGASSAGKRFAAKHSEVMFLPGLEPEKTKAVV
DDMRYDPIHFSLETRLTNSRKHLAEIGRPTDSIKFIAGILVIVDETDEKAQAKYEEYLAQ
SDLEGVATLFGGWTNNDLSKFDDDEDFSFTAVGGIQSLISSWSKTVPNSNGLKWTKRRVL
QELALGGAHPRAIGSPSTVADILQRWVDVAGVDGFNFSYAVSPGTFEDMIEYLFPELRRR
GVIWDDYEAKGGSARENYFQDGLGSRLREGHPGREYTWN

Enzyme Prediction     

No EC number prediction in KAB8212079.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	18	380	1.6e-156	0.9942363112391931

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274819	FMN_nitrolo	3.57e-180	406	857	1	422	FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family. This model represents a distinctive clade, in which all characterized members are FMN-binding, within the larger family of luciferase-like monooxygenases (LLM), among which there are both FMN- and F420-binding enzymes. A well-characterized member is nitrilotriacetate monooxygenase from Aminobacter aminovorans (Chelatobacter heintzii), where nitrilotriacetate is a chelating agent used in detergents. [Unknown function, Enzymes of unknown specificity]
238528	Nitrilotriacetate_monoxgenase	4.92e-88	406	842	1	357	nitrilotriacetate monoxygenase oxidizes nitrilotriacetate utilizing reduced flavin mononucleotide (FMNH2) and oxygen. The FMNH2 is provided by an NADH:flavin mononucleotide (FMN) oxidorductase that uses NADH to reduce FMN to FMNH2.
225052	SsuD	2.23e-58	424	842	4	333	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) [Coenzyme transport and metabolism, General function prediction only].
395232	Bac_luciferase	1.25e-49	409	814	3	314	Luciferase-like monooxygenase.
238527	Alkanesulfonate_monoxygenase	2.01e-36	409	716	3	244	Alkanesulfonate monoxygenase is the monoxygenase of a two-component system that catalyzes the conversion of alkanesulfonates to the corresponding aldehyde and sulfite. Alkanesulfonate monoxygenase (SsuD) has an absolute requirement for reduced flavin mononucleotide (FMNH2), which is provided by the NADPH-dependent FMN oxidoreductase (SsuE).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39170.1|PL9_3	2.15e-274	1	391	1	391
QMW27106.1|PL9_3	2.15e-274	1	391	1	391
UDD54928.1|PL9_3	2.15e-274	1	391	1	391
BAE63970.1|PL9_3	5.95e-274	1	391	28	418
QRD81454.1|PL9_3	5.95e-274	1	391	28	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6AK1_A	1.20e-135	401	876	2	452	Crystal structure of DmoA from Hyphomicrobium sulfonivorans [Hyphomicrobium sulfonivorans],6AK1_B Crystal structure of DmoA from Hyphomicrobium sulfonivorans [Hyphomicrobium sulfonivorans]
3B9N_A	6.71e-121	406	876	7	433	Crystal structure of long-chain alkane monooxygenase (LadA) [Geobacillus thermodenitrificans],3B9N_B Crystal structure of long-chain alkane monooxygenase (LadA) [Geobacillus thermodenitrificans],3B9O_A long-chain alkane monooxygenase (LadA) in complex with coenzyme FMN [Geobacillus thermodenitrificans],3B9O_B long-chain alkane monooxygenase (LadA) in complex with coenzyme FMN [Geobacillus thermodenitrificans]
6LR1_A	6.03e-88	405	876	6	446	Hexachlorobenzene Monooxygenase (HcbA1) from Nocardioides sp. strain PD653 [Nocardioides sp. PD653],6LR1_B Hexachlorobenzene Monooxygenase (HcbA1) from Nocardioides sp. strain PD653 [Nocardioides sp. PD653],6LR5_A Hexachlorobenzene monooxygenase (HcbA1) from Nocardioides sp. strain PD653 complexed with FMN [Nocardioides sp. PD653],6LR5_B Hexachlorobenzene monooxygenase (HcbA1) from Nocardioides sp. strain PD653 complexed with FMN [Nocardioides sp. PD653],7CZA_A Hexachlorobenzene monooxygenase (HcbA1) from Nocardioides sp. strain PD653 complexed with FMN [Nocardioides sp. PD653],7CZA_B Hexachlorobenzene monooxygenase (HcbA1) from Nocardioides sp. strain PD653 complexed with FMN [Nocardioides sp. PD653]
5W48_A	6.06e-71	422	876	29	452	Crystal Structure of Riboflavin Lyase (RcaE) [Herbiconiux],5W48_B Crystal Structure of Riboflavin Lyase (RcaE) [Herbiconiux],5W4Y_A Crystal Structure of Riboflavin Lyase (RcaE) with cofactor FMN [Herbiconiux],5W4Y_B Crystal Structure of Riboflavin Lyase (RcaE) with cofactor FMN [Herbiconiux],5W4Z_A Crystal Structure of Riboflavin Lyase (RcaE) with modified FMN and substrate Riboflavin [Herbiconiux],5W4Z_B Crystal Structure of Riboflavin Lyase (RcaE) with modified FMN and substrate Riboflavin [Herbiconiux]
5TLC_A	3.36e-62	406	857	7	441	Crystal structure of BdsA from Bacillus subtilis WU-S2B [Bacillus subtilis],5TLC_B Crystal structure of BdsA from Bacillus subtilis WU-S2B [Bacillus subtilis],5TLC_C Crystal structure of BdsA from Bacillus subtilis WU-S2B [Bacillus subtilis],5TLC_D Crystal structure of BdsA from Bacillus subtilis WU-S2B [Bacillus subtilis],5XKC_A Crystal structure of dibenzothiophene sulfone monooxygenase BdsA at 2.2 angstrome [Bacillus subtilis],5XKC_B Crystal structure of dibenzothiophene sulfone monooxygenase BdsA at 2.2 angstrome [Bacillus subtilis],5XKC_C Crystal structure of dibenzothiophene sulfone monooxygenase BdsA at 2.2 angstrome [Bacillus subtilis],5XKC_D Crystal structure of dibenzothiophene sulfone monooxygenase BdsA at 2.2 angstrome [Bacillus subtilis],5XKD_A Crystal structure of dibenzothiophene sulfone monooxygenase BdsA in complex with FMN at 2.4 angstrom [Bacillus subtilis],5XKD_B Crystal structure of dibenzothiophene sulfone monooxygenase BdsA in complex with FMN at 2.4 angstrom [Bacillus subtilis],5XKD_C Crystal structure of dibenzothiophene sulfone monooxygenase BdsA in complex with FMN at 2.4 angstrom [Bacillus subtilis],5XKD_D Crystal structure of dibenzothiophene sulfone monooxygenase BdsA in complex with FMN at 2.4 angstrom [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9JFX9|DMOA_HYPSL	4.77e-135	401	876	2	452	Dimethyl-sulfide monooxygenase OS=Hyphomicrobium sulfonivorans OX=121290 GN=dmoA PE=1 SV=1
sp|A4IU28|LADA_GEOTN	3.45e-120	406	876	7	433	Long-chain alkane monooxygenase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=ladA PE=1 SV=1
sp|P54950|SCMK_BACSU	1.50e-64	398	858	2	430	N-acetyl-S-(2-succino)cysteine monooxygenase OS=Bacillus subtilis (strain 168) OX=224308 GN=scmK PE=3 SV=1
sp|P54989|NTAA_AMIAI	7.39e-64	406	848	7	432	Nitrilotriacetate monooxygenase component A OS=Aminobacter aminovorans OX=83263 GN=ntaA PE=1 SV=2
sp|O34974|MOXC_BACSU	1.24e-60	422	857	23	425	Putative monooxygenase MoxC OS=Bacillus subtilis (strain 168) OX=224308 GN=moxC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000413	0.999542	CS pos: 18-19. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in KAB8212079.1.