CAZyme Information: KAB8211919.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8211919.1
• CAZy Family: GT45
• CAZyme Description: fibronectin type III domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
973		106704.59	4.1571

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734937:387159-390712(-)

Full Sequence      

MHGQPLHGLVVIATLGGCTLANPLAYWNMQGNASLNSERLMGRDTTEFYQTDLSFIKRMA
AIGDSYSAGIGAGGRLGSVAEALVSNSDWACSRYDHSYPYLIHNDERLGDPDARTFQFKS
CSGAVIDDVINDQIPSISGNQQVILLSAGGNDAELSNILNQCIFQWSALKAVEVNEAKTV
ALANQDYTWAETFDWDSLGYGCEGQLTRTRNIIDGDAFSIRLDSIIEAAKEKLASDYAKF
FAEDLSSECDDVSWSTWLYPFQGSEKLTKDHRKIMNELVDAANSQIVLKFVDYDSYVGHF
NGRFCEKGVDESTAESNTRTGLMFYELNTWDPRGNSPWKRSVDYPLEGTFEGTVNQLAQI
TLLMDSDAQFADQDMISDASAASIATYDEVELSSVEIPNILPDGWMMDNRYGRVFHPQIL
LHQIIAELVIYEMVNKNEQDNGLPAIPEELSFSSCPRFPSSGSNASDGQQIAVASYINPL
ADPAAWDRLIKYPLEKMPILVANVVNGPDSAVDKTWTDVIDRASASGKTVLGYVRTGYLG
VSDQKFTTRLGSGNLADWTAQIEEDVDMWYTLYGSRIGGIFFDEGWPECGDNNEYVDLYK
YINDYTKRTHPGAYTVLNPGSPMASCFEDTMDTLLTFELSYEAYTNSYTPNDWTPKDPRK
LWHIVYNVPESAVSEVTKLANERGAGMMDAIEGGSPLNTDASSWTSGSAAGAVSGLSVLD
SDYTSAKLSWDAALNALGYYVYSGDSIIASVPSSMTTITIGGLQPGARHIFHVSAVGGGG
NIGSASMTVPVITESLPDGNTIANYHSSPGPDSTTITADILVPYAFIRLYIWDSVGCEFD
TNPGWSVNFKIDEYVCTHYMVEGTTLYKYSGTLPEGSTAPPWAWSVVGPITLDTKDYTYT
WTLPLGTSTIDTSKFVIQAQGYNPLTNVFEPDPSDYDCKGSSMCTTPSFLKWCDHAVNTL
QRNDVPSYFPTSA

Enzyme Prediction     

No EC number prediction in KAB8211919.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	472	685	1.3e-19	0.8818565400843882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	9.62e-43	476	687	1	214	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
238861	SEST_like	1.57e-24	57	308	1	224	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
238020	FN3	3.39e-08	711	793	2	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
214495	FN3	2.63e-06	711	780	2	81	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
406036	MU117	1.20e-04	937	964	1	27	Meiotically up-regulated gene family. This protein was identified as being up-regulated during meiosis in S.pombe. This family of proteins is found in largely in plants and fungi. Proteins in this family are typically between 128 and 920 amino acids in length.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11365.1|GH0	0.0	1	962	1	1024
BCR99052.1|GH0	0.0	1	962	1	1024
CCT67685.1|CE0	2.74e-120	4	460	2	461
QGI80975.1|CE0	2.78e-120	4	460	2	461
UNO38501.1|CE3|GH0	2.37e-114	460	936	486	990

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HYQ_A	2.28e-11	61	178	7	110	Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 [Streptomyces albidoflavus]
5MAL_A	2.86e-08	61	178	6	109	Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus],5MAL_B Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9S2A5|LIP1_STRCO	2.63e-09	61	165	40	130	Lipase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1725 PE=1 SV=1
sp|Q93MW7|LIP_STRRM	2.15e-07	61	178	40	143	Lipase OS=Streptomyces rimosus OX=1927 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004755	0.995229	CS pos: 17-18. Pr: 0.7129

TMHMM  Annotations     

There is no transmembrane helices in KAB8211919.1.