CAZyme Information: KAB8211847.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8211847.1
• CAZy Family: GT4
• CAZyme Description: polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	ML734937|CGC4	46110.40	6.3336

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734937:204865-206596(-)

Full Sequence      

MQLGAAALFLALPNPVAPKNTGKTCTVIPLGGKQDDVPQILAAFKECNHGGRVVFPEGHT
YWIAQKLNPVVTDVTVDWKGTWLFSDDIEKWRNNTYWIEFQNHWTAFALSGKRIHINGHG
TGGINGSGNSWYNVEKAFTQPGRPMAFTPWNVTDLHVEHFSIIDSPLWALFIINGTNSKF
DDIIVNSTAVNAPWGTNWVQNTDGFDTMDSRNISLTNFIYQGGDDAIAIKPRSYGIYMQN
VTIHGGNGPAIGSLGQYLEDNSVKDIIMRDVHILSYNEDMKNAAYVKTWVGELVPQDPSK
NGWYESGGKPRGGGWGNVTNIRFENFHVEGASAGASINQNSGDNGSYAGTSKMLVSDVTF
VNFTGYINNSKSGSVSCSKRYPCYNIAFEDFSLAQGSNGTATNATGSCSYIKPGGVIGLN
GCGN

Enzyme Prediction     

No EC number prediction in KAB8211847.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	46	411	8.8e-61	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.74e-24	73	409	25	320	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	6.61e-24	31	404	59	404	Probable polygalacturonase
177865	PLN02218	3.34e-23	32	404	79	418	polygalacturonase ADPG
178580	PLN03003	1.00e-19	32	421	35	385	Probable polygalacturonase At3g15720
215540	PLN03010	2.97e-16	32	401	58	382	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD54702.1|GH28	7.58e-315	1	424	8	447
QRD81220.1|GH28	1.26e-313	1	424	8	447
QMW38981.1|GH28	1.13e-244	1	422	8	383
QMW26901.1|GH28	1.13e-244	1	422	8	383
ATZ55904.1|GH28	8.91e-198	15	423	30	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	9.12e-23	35	365	30	330	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAY7|RGXC_ASPNC	3.50e-182	1	422	1	423	Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxC PE=2 SV=1
sp|A1D415|RGXC_NEOFI	8.25e-159	1	422	6	423	Putative galacturan 1,4-alpha-galacturonidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rgxC PE=3 SV=1
sp|Q2EQQ2|RGXA_ASPNG	1.40e-70	6	400	13	420	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	7.72e-70	6	400	13	420	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|B8NJB0|RGXA_ASPFN	1.69e-63	22	393	28	412	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.015647	0.984321	CS pos: 18-19. Pr: 0.9490

TMHMM  Annotations     

There is no transmembrane helices in KAB8211847.1.