CAZyme Information: KAB8211481.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8211481.1
• CAZy Family: GT31
• CAZyme Description: nucleotide-diphospho-sugar transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	ML734938|CGC9	46234.88	4.8049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734938:185740-186954(-)

Full Sequence      

MTSSMSGVCLPRQIRRIIPGCLAAILFVSYLSMTDTFSELSDGLSYRSCETHRFFPKKIW
QSWKVAPFEFEERDLTVARSWTSKNPGYRYEVLTDQNDLYYVETHFGPDGFNRPDIVDTY
RTLTAQIIKADLLRYLIMYVDGGVWADIDVEALRPIDRFIPERYDEHDIDMVIGVEIDEP
DFNDHPILGQKSQSFCQWTFMAKPRQPVMMRLVNHILEWLNELSIKQGKPIAELELEFDD
IISGTGPSAFTAAVLAEMSSNAGHEVTWKTFHNIPESKLVGGFLVLTVEAFAAGQGHSDS
GNHNSRSALIKHHYHASGWPSKHPRHNHPVYGEVEQCNWNKECVAQWDSNTAAFAALSPE
EQEHQIALKRALDGEANPVQDQTAWINPDPDPEWREPEWQPEWQ

Enzyme Prediction     

No EC number prediction in KAB8211481.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	77	162	6.4e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.76e-25	33	283	59	312	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.06e-13	72	162	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83354.1|GT32	1.53e-305	1	404	1	404
QMW40889.1|GT32	6.23e-304	5	404	1	400
BAE58544.1|GT32	6.23e-304	5	404	1	400
UDD56882.1|GT32	6.23e-304	5	404	1	400
QMW28814.1|GT32	7.27e-303	5	404	1	400

PDB Hits     

KAB8211481.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.02e-34	52	319	139	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.95e-31	50	291	125	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	2.79e-29	38	312	81	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	7.89e-22	39	234	79	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.87e-07	56	160	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999759	0.000259

TMHMM  Annotations     

There is no transmembrane helices in KAB8211481.1.