CAZyme Information: KAB8211109.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8211109.1
• CAZy Family: GT22
• CAZyme Description: cryptococcal mannosyltransferase 1-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		46525.25	8.3031

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734939:12726-14051(+)

Full Sequence      

MKAYLYSLYRKTRRLRLVLFFFLVGWTLVEVLRIKYTLVQQSQPELVALGREKIYITGLH
WNSEQILREAWIAAVVDLANTIGRDNVFVSIQESGSWDDTKGALILLDQLLAENDIPRRI
LIDYTTHFDEISKPPTGQGWIETPIGTTELRRVPYLARLRNVAMEPLYQRQTEGIMYDKI
LFLNDVVFTTSDVQKLLSTRGGNYAATCSLDFSKPPNFYDTFALRDAEGHDMLMQSWPYF
RSRASRQAMKDSQPVPVSSCWNGVVAMDSSPFYQDPPLKFRGISDSLARSHLEGSECCLI
HADNPLSREKGVWLNPNVRVGYNAPAYLAVNPMENSWLSSFTIVSGLWRNRFLRWFTTPW
FKENIVWTRLWKWEKQSGGNKESGPFCLINEMQVLTENGWAHR

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	53	305	1e-86	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	4.68e-120	53	300	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89692.1|GT69	4.78e-288	1	403	1	403
QMW30798.1|GT69	4.78e-288	1	403	1	403
QMW42851.1|GT69	4.78e-288	1	403	1	403
UDD59634.1|GT69	4.78e-288	1	403	1	403
BAE60536.1|GT69	6.38e-218	1	317	1	317

PDB Hits     

KAB8211109.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	8.12e-09	142	322	202	395	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999848	0.000162

TMHMM  Annotations     

Start	End
17	34