CAZyme Information: KAB8210396.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8210396.1
• CAZy Family: GT1
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	ML734942|CGC1	57988.76	9.6510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734942:127649-129661(+)

Full Sequence      

MSATFASPGWDILIAKPIGSVALLGSLLKDSNNLSTIMSILPDRYYRSLLLNFVSWKALL
LLLVVFSPGPAYDTSTALRTLGRNVANTDRHGLLTPVLGLLATNLTRWDAIYFTEIARRG
CLFEQEWAFNLGFASLIRAFADGEDTWPQRALDMPTNYMSVLRHTAGINPALIESIIGIA
VAHAAHGMSVFVLYSLARSVFPGRKGRNLAFIAACLHILSPAGLFLSAPYGESTHALLSF
MGSLLFVLSFNHAGASTSLRDALTLLSGIFYGLATAARSNGLLNGMILLEEAVRLLYSMT
EGITFAKTRRLIAVGMAGICTGLGFVIPQYIAYKQFCMNDKDPRVWCLRTIPSIYSFVQD
HYWNNGFLRYWTLSNIPLFALAGPMLVIMTYSAIWTLGVGSDGQERGNGESSSNMPKTQV
HSEAPLTGRLLRSLAAPQITLAILTFLKHHVQIITRMSSGYPVWYLWLAHALVEGHSLAS
SEKVGVCRGKKETQIMKQYRYARMTVFYMIVYALIQGVLFASFLPPA

Enzyme Prediction     

No EC number prediction in KAB8210396.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	51	527	4.9e-117	0.9926289926289926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	7.29e-44	49	527	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.29e-13	149	527	90	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62404.1|GT76	0.0	15	527	11	523
QMW44188.1|GT76	7.51e-316	38	527	1	472
QRD83592.1|GT76	5.08e-314	38	527	1	472
QMW32162.1|GT76	5.08e-314	38	527	1	472
UDD57107.1|GT76	5.08e-314	38	527	1	472

PDB Hits     

KAB8210396.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	1.47e-97	46	527	19	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	9.92e-91	42	527	15	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	3.98e-90	53	527	18	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	4.53e-87	42	527	26	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q09712|GPI18_SCHPO	1.99e-38	107	527	127	464	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998903	0.001098

TMHMM  Annotations     

Start	End
10	28
49	71
175	197
209	231
236	255
311	333
376	398
504	526