CAZyme Information: KAB8209436.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8209436.1
• CAZy Family: GH76
• CAZyme Description: family 26 endoglucanase H/Glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	ML734947|CGC7	38421.06	6.6548

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734947:574939-575967(+)

Full Sequence      

MLAKFSFLSLILTSTAFAAGGQGLSYDNIDKSATPGAKALLKYIQSQYGSHYISGQQDAG
SWDWVKQNIGVSPAILGSDFMYYSPSAVAHGSKSHAVEDVIQHADRNGINALVWHWYAPN
CLLDNAEQPWYSGFYTKATCFNVADAVNDRRNGTNYRLLLRDIDAIAAQIKRLDQANVPI
LFRPLHEPEGGWFWWGAQGPAPFKKLWDMIYDRITRFHNLHNVVWVCNTAEADWYPGNDK
CDIATVDHYADAGDHGVLADKYKKLQAVTNNERVLALAEVGPVPDPTVQARDKVNWAYWM
VWNDEFIKDGKQNSKQFLQNVYNNTRVVTLDGGSRLGNWNNA

Enzyme Prediction     

EC	3.2.1.78:13	3.2.1.151:5	3.2.1.4:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	30	331	4.6e-96	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396639	Glyco_hydro_26	8.86e-53	29	331	1	310	Glycosyl hydrolase family 26.
226609	ManB2	7.63e-10	176	283	178	298	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91147.1|GH26	5.69e-258	1	342	1	341
QMW34827.1|GH26	5.69e-258	1	342	1	341
QMW46900.1|GH26	5.69e-258	1	342	1	341
BAE64615.1|GH26	9.44e-257	1	342	1	341
UDD63858.1|GH26	9.44e-257	1	342	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	2.18e-100	32	331	149	445	Chain A, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.72e-95	29	331	7	308	Structure of Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	3.38e-51	24	331	30	350	Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	1.84e-33	22	331	17	325	The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	6.85e-33	31	309	48	322	The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R6F5|MA26A_ASPNC	2.36e-210	1	331	1	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
sp|G2Q4H7|MA26A_MYCTT	2.77e-96	32	331	178	474	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
sp|Q5AWB7|MANE_EMENI	7.04e-94	4	340	2	354	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
sp|P49425|MANA_RHOM4	2.76e-79	30	331	148	455	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
sp|P55296|MANA_PIRSP	1.28e-42	29	331	158	458	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999732	CS pos: 18-19. Pr: 0.9814

TMHMM  Annotations     

There is no transmembrane helices in KAB8209436.1.