CAZyme Information: KAB8209416.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8209416.1
• CAZy Family: PL1
• CAZyme Description: nucleotide-diphospho-sugar transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619	ML734947|CGC2	69709.67	9.2026

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734947:524913-526884(+)

Full Sequence      

MIKKLRYKIQELPVEKVSRFTYLAQQVTPSAAQVALWLSAIYRIIRLLCLILSANITSLM
WCFFFVECAFIYECCGEQFFTLTSAKGELAPHLPQLRLVGQNDLPLVEIFVPCCGESLDI
ILDTVRAACAIDYPTARFCVTVLDDGTSAALHKAIADLCKIWPNLSYHSRGVKPNAKVFA
KAGNLNYGLFEIKRPFPPEFIAIMDADCMPTPDFLRATLPHMLTRSKLAIVGSAQYYYNL
PDGDPLDQALDYYSAIKIPQLNRLGKSFASGSGCVIRYSTLLKTGGFPTFGSVEDVTLSS
LLTQSGDQILVLTEMVQLGLIPGSFEGHVLQTSRHKVGVSEQILNWSPSTSNTIPPRYRP
ALGWIGLSLTWKIVARFITNIFIPLALASGQQLVPATLLRLQMVLAVSYISSFWLYEWLR
AAHTGFRVSTFHHLREWFLATRHMYALLHFYLFSFQSSSKWPARSVVTGSTQNPWNVPPA
SQSQAKRFYKDFFAPTVLINMIYFMGTFVTIAYSIWSCYSENSGNDKLFTRVAWPPMLLL
CYLILTSSFTPLRCSIWPLRYPNRKLALGPHPNHAQAVFPKEDVRLAVMKRQRPPLGEFY
HLVLVPVVLAALMYFALVV

Enzyme Prediction     

No EC number prediction in KAB8209416.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	7.77e-66	105	344	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133045	CESA_like	9.61e-24	109	295	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	2.32e-22	103	453	52	405	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	3.75e-19	109	344	2	232	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
133059	CESA_CaSu_A2	1.17e-17	105	334	1	227	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91169.1|GT2	1.43e-240	73	471	14	379
QMW34845.1|GT2	4.69e-201	1	619	1	359
QMW46918.1|GT2	4.40e-199	1	619	1	359
QGA14290.1|GT2	4.98e-132	1	612	1	615
BCS12365.1|GT2	1.11e-121	1	613	1	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	5.27e-13	63	348	86	384	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.59e-13	63	348	98	396	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	5.59e-13	63	348	99	397	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	1.02e-12	105	339	273	501	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P58932|BCSA_XANAC	9.31e-17	105	341	153	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q7PC76|CSLA1_ORYSJ	1.33e-15	99	338	78	319	Glucomannan 4-beta-mannosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA1 PE=1 SV=1
sp|Q9FNI7|CSLA2_ARATH	1.39e-15	99	338	91	332	Glucomannan 4-beta-mannosyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=CSLA2 PE=1 SV=1
sp|P58931|BCSA_PSEFS	2.02e-15	102	341	156	389	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
sp|Q6UDF0|CSLA1_CYATE	5.53e-15	97	407	83	395	Glucomannan 4-beta-mannosyltransferase 1 OS=Cyamopsis tetragonoloba OX=3832 GN=ManS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999147	0.000827

TMHMM  Annotations     

Start	End
44	66
396	418
497	519
534	556
599	618