CAZyme Information: KAB8209367.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8209367.1
• CAZy Family: GH76
• CAZyme Description: cryptococcal mannosyltransferase 1-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447		50560.93	6.6110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734947:393590-394933(-)

Full Sequence      

MWPATDSLGFKLDWKFAQRHVLRLAGATAALLVVAFLYINFNVGSSTMGEAIRVNNKTQS
CIDFDPATVSEKLHSTIRLKQHTYNNAEISEFVCSILNHDMNLTAKLDCSVSIDSRYEHL
RPSPSGAPRIQYYFALDLYQAVHIILPLMGAIMEAIRYLGPEYCALSIVEGRSTDGTYAI
LAGLKTELAAMGVPYFLVRDYLDPKAGGENRITALSHLRNLALEPLLEESKSKHSRLAPK
PTIIFVNDIVICPEDILELIHQRVIQSASMTCAFDWNKNAGNFYDAWVSRSMSGNLFFEV
THDGKHWLGNDMFFDHPDSAARWDQTLPIQVYSCWGGMVTLDAEPFIRGKITFRSSDKEE
CYMGEPMTLAKDLWKMGRGQILAVPSVNTGYEYDQARDAKGRRGYVHEIVNHTQYNTEAE
LVKWQKAPPPMVKCMPVFERQWWTTPV

Enzyme Prediction     

No EC number prediction in KAB8209367.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	131	375	3.4e-78	0.99581589958159

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	9.45e-87	131	366	1	222	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE64674.1|GT69	0.0	1	447	1	447
QRD91215.1|GT69	0.0	1	447	13	459
UDD63923.1|GT69	0.0	1	447	13	459
QMW46959.1|GT69	9.71e-316	1	438	1	438
QMW34887.1|GT69	3.92e-315	1	438	1	438

PDB Hits     

KAB8209367.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	6.90e-38	108	436	109	443	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000002

TMHMM  Annotations     

Start	End
21	43