CAZyme Information: KAB8208851.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8208851.1
• CAZy Family: GH62
• CAZyme Description: chitin synthase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1119	ML734949|CGC3	126790.62	6.4567

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734949:209047-213839(+)

Full Sequence      

MSSRRPSSLANTSSDSEISHCPPYQEQHSFYPEGRDEQEISLLQENSSSHYSIPFADPLA
ESDSHRRYTLHDPGPTTFGAPEYEPVQSSGMKTRAGLNRYGTRKINLVKGAVLSVDYPVP
SAIQNAIQPEYRDAEEAFSEEFTHLRYTAATCDPDEFTLRNGYNLRPAMYNRHTELLIAV
TYYNEDKVLTSRTLHGVMQNIRDIVRLKKSEFWNKGGPAWQKIVVCLIFDGIEPCDKNTL
DVLATIGVYQDGIMKKDVDGRETVAHVFEYTTQLSVTATQQLVRPHSDESTSNLPPVQFI
FCLKQKNSKKINSHRWLLNAFSRILNPEVIVLLDAGTKPGPKSLLSLWEAFYNDKTLGGA
CGEIHAMLGPRWQKCLNPLVAAQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRYRAIM
GRPLEQYFHGDHTLSQRLGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGFKWHLSYVKA
AKGETDVPEGAAEFVGQRRRWLNGSFAAGLYAIMHFGRIYRSGHSIIRLFFLHIQILYNI
CQLIMTWFSLVVGVFTGGMLDFNFDDGLAAFIQSFFSSSGGGIVLIALVSTYGIYIIASI
LYLDPWHILTSSWAYFLGMTTSINVLMVYSFCNWHDVSWGTKGSDKVDALPSVTTQKDDN
KKNFIEELDKPQADIDSQFEATVKRALAPYVEPEEDGGKTLDDSYKNFRTGLVCLWVFSN
LLLTLMITATGVDKICLTNTSTTRTTWFFQIILWITAGLSLFRFIGSLYFLGRAGVLCSL
RWKLAQKNNIPLRYPTYEALLNSYKITYNHRRELNGDNGAPTFLETYYEGCQVLCTEDDF
YELAMTYFQKAKDMNVRYVEPFFDTQAHTKRGIPVEAVLDGFLRAQHDGAKQLGVKSNWI
FCFLRDHPVEEGLEALRSALPWARTKDGKGKGLFHAVGLASNEYDRPPGLFEEGFLLAKE
TGLHVTMHCDVDQKDVVEHMREGIFDVCESAGADRIDHGLNAIDSPELMAALKEKNIGLT
LCPHAYHRRQATEVLFPKIRRLWDEGVRFCINSDDPTYMHDVWIDGNMMKVYEYCGFTKS
EMGKLVRNAVEMSWADEATKTEILDELERVLGVEEKLIR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	182	351	2.6e-69	0.9938650306748467
GT2	328	642	8.2e-23	0.5483870967741935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	3.88e-96	182	351	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.48e-88	178	508	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
238645	ADA	2.68e-79	783	1107	22	325	Adenosine deaminase (ADA) is a monomeric zinc dependent enzyme which catalyzes the irreversible hydrolytic deamination of both adenosine, as well as desoxyadenosine, to ammonia and inosine or desoxyinosine, respectively. ADA plays an important role in the purine pathway. Low, as well as high levels of ADA activity have been linked to several diseases.
236480	PRK09358	3.37e-74	779	1112	22	339	adenosine deaminase; Provisional
224729	Add	8.33e-63	782	1107	30	337	Adenosine deaminase [Nucleotide transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW30279.1|GT2	0.0	1	778	1	866
QRD86753.1|GT2	0.0	1	778	1	866
QMW42351.1|GT2	0.0	1	778	1	866
BAE59695.1|GT2	0.0	1	778	1	871
UDD62022.1|GT2	0.0	1	712	1	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OU8_A	1.91e-41	780	1091	27	313	The crystal structure of adenosine deaminase from Pseudomonas aeruginosa [Pseudomonas aeruginosa],3OU8_B The crystal structure of adenosine deaminase from Pseudomonas aeruginosa [Pseudomonas aeruginosa],3PAN_A The crystal structure of adenosine deaminase with hypoxanthine bound from Pseudomonas aeruginosa [Pseudomonas aeruginosa],3PAN_B The crystal structure of adenosine deaminase with hypoxanthine bound from Pseudomonas aeruginosa [Pseudomonas aeruginosa],3PAO_A The crystal structure of adenosine deaminase with adenine bound from Pseudomonas aeruginosa [Pseudomonas aeruginosa],3PAO_B The crystal structure of adenosine deaminase with adenine bound from Pseudomonas aeruginosa [Pseudomonas aeruginosa],3PBM_A The crystal structure of adenosine deaminase in complex with chloropurine from Pseudomonas aeruginosa [Pseudomonas aeruginosa],3PBM_B The crystal structure of adenosine deaminase in complex with chloropurine from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
3RYS_A	1.89e-35	780	1107	30	332	The crystal structure of adenine deaminase (AAur1117) from Arthrobacter aurescens [Paenarthrobacter aurescens TC1],3RYS_B The crystal structure of adenine deaminase (AAur1117) from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
4GXW_A	8.75e-17	833	1100	87	346	Crystal structure of a cog1816 amidohydrolase (target EFI-505188) from Burkhoderia ambifaria, with bound Zn [Burkholderia ambifaria AMMD],4GXW_B Crystal structure of a cog1816 amidohydrolase (target EFI-505188) from Burkhoderia ambifaria, with bound Zn [Burkholderia ambifaria AMMD]
6N91_A	4.54e-15	783	1104	26	327	Crystal Structure of Adenosine Deaminase from Vibrio cholerae Complexed with Pentostatin (Deoxycoformycin) [Vibrio cholerae O1 biovar El Tor str. N16961],6N91_B Crystal Structure of Adenosine Deaminase from Vibrio cholerae Complexed with Pentostatin (Deoxycoformycin) [Vibrio cholerae O1 biovar El Tor str. N16961]
6N9M_A	6.60e-12	784	1112	27	335	Crystal Structure of Adenosine Deaminase from Salmonella typhimurium with Pentostatin (Deoxycoformycin) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30602|CHS3_EXODE	0.0	36	739	28	864	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|Q92197|CHSC_ASPFU	0.0	34	778	33	888	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P29070|CHS1_NEUCR	0.0	87	778	130	912	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|P54267|CHSG_ASPFU	0.0	45	778	97	906	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2
sp|Q00757|CHSB_EMENI	0.0	32	778	88	911	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000014

TMHMM  Annotations     

Start	End
500	517
538	560
580	602
609	631
710	732
745	767