CAZyme Information: KAB8208702.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8208702.1
• CAZy Family: GH53
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		50289.71	4.5191

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734950:390387-393683(+)

Full Sequence      

MFWMSLRAFLWRLPFLVGVEVTRCGVDFVGDDSLKQAGKAVAAPMMDFYKKNETEGIPGK
LTDTWYVAGSMFMTLIQYWQASGDDTYNAVVSHDLMFQAGENYDYYSKNVSDWLGNDDQM
FWGLATITASEAGFPEISGKPSWTSLARVVFNMEAERWDKSACNGGMRWQLWPYQEGYTM
KNAISNGGLFELAARLARFTKNETYSEWADRIWDWSASTPLLQTDRWYIADSTSNLNNCS
DAGDQQWSYNYGTYLAGAAFMYNHTNGSDKWLKRVDGLLNSVLTTFFPKEGNGVVLSEVA
CEPILTCDRNQLCFKGYVAMWLAFTAILVPSTRERITPKLQGSAAAISKQCSGGDQNLCG
ERWYSTEPVGPTGLEVQMAALGGITSNLMLFEAQSPKTIESNPNATETEIDHHSDEEPNK
PKPITTGDRAGAGIITVVVAIAVAGTVVWMIVP

Enzyme Prediction     

No EC number prediction in KAB8208702.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	33	399	1.9e-100	0.952513966480447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	33	381	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE61270.1|GH76	0.0	1	453	1	453
QMW43816.1|GH76	0.0	25	453	27	455
QRD90835.1|GH76	0.0	25	453	27	455
QMW31786.1|GH76	0.0	25	453	27	455
UDD60736.1|GH76	0.0	25	453	27	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.35e-82	32	429	34	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	5.44e-92	25	451	18	445	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.32e-90	26	451	24	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	9.85e-88	26	451	21	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	4.12e-87	26	405	22	406	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	1.06e-86	33	452	31	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.494658	0.505338	CS pos: 24-25. Pr: 0.3981

TMHMM  Annotations     

Start	End
430	452