CAZyme Information: KAB8207749.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8207749.1
• CAZy Family: GH43
• CAZyme Description: glycoside hydrolase superfamily

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	ML734955|CGC6	47380.09	4.5168

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734955:370646-372082(+)

Full Sequence      

MEVSSGSRAEHRPIHAWVQNSYQGRISPDYKNSWTPSNNGQPVRASTMKLNPSLLTAAGL
VSAQLASALPQASSSTVSPSPSPSATPGSFVTTSGLNFVIDGKTGYFAGSNSYWIGFQKN
NDDVDLVFSHLQESGLKILRVWGFNDVNEKPTDGSVYYHLLADGTATVNEGEDGLQRLDY
VVSSAEKYGIKLIINFVNFWDDYGGINAYVKAFGGSKEDFYTNDAMQEAYRAYIKAVISR
YSDSTAIFAWELANEPRCQGCETTVLYNWIESTSQYIKSLDSKHLVCIGDEGFGLDTGSD
GSYPYQYSEGSDFAKNLAIPTIDFGTFHLYPSSWGTTNEWGNGWVTSHGAACKAAGKPCM
FEEYGVTSDHCAVEKPWQNTALNTTAISADLYWQYGDQLSGGQSPDDGNTFYYGTDEFTC
LVTDHIAAINSRK

Enzyme Prediction     

EC	3.2.1.78:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	122	395	3.1e-90	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	1.65e-27	98	425	4	305	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
395098	Cellulase	1.14e-08	156	368	45	240	Cellulase (glycosyl hydrolase family 5).
225344	BglC	4.08e-08	94	342	32	293	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65966.1|GH5_7	5.35e-311	1	433	1	449
QRD92290.1|GH5_7	1.79e-309	1	433	1	449
QMW48707.1|GH5_7	1.79e-309	1	433	1	449
QMW36651.1|GH5_7	1.79e-309	1	433	1	449
BAE66031.1|GH5_7	3.26e-285	48	433	1	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WH9_A	3.60e-192	89	431	1	344	The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger],3WH9_B The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger]
3WFL_A	3.50e-182	90	429	3	342	Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus [Talaromyces trachyspermus]
1QNO_A	1.76e-156	89	430	3	344	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]
3ZIZ_A	4.72e-156	94	431	19	356	Chain A, Gh5 Endo-beta-1,4-mannanase [Podospora anserina]
4AWE_A	6.31e-79	87	432	3	387	The Crystal Structure of Chrysonilia sitophila endo-beta-D-1,4- mannanase [Neurospora sitophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXJ2|MANA_ASPOR	5.80e-286	48	433	1	386	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=manA PE=3 SV=1
sp|B8NVK8|MANA_ASPFN	1.66e-285	48	433	1	386	Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=manA PE=3 SV=2
sp|Q0CCD0|MANA1_ASPTN	1.93e-220	48	432	1	384	Probable mannan endo-1,4-beta-mannosidase A-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=manA-1 PE=3 SV=1
sp|Q00012|MANA_ASPAC	4.45e-200	48	433	1	376	Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=manA PE=1 SV=1
sp|A1D8Y6|MANA_NEOFI	1.10e-199	90	433	26	370	Probable mannan endo-1,4-beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=manA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.986749	0.013263

TMHMM  Annotations     

There is no transmembrane helices in KAB8207749.1.