CAZyme Information: KAB8207379.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8207379.1
• CAZy Family: GH31
• CAZyme Description: pectate lyase superfamily protein-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824		87394.39	4.9659

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734957:265865-268630(-)

Full Sequence      

MVFSSVFRTFALCLLITYAWAGGIQDLVNTLMEPVEDTFSFLPPLDWVPHPKGIPFPTKN
ETAEPWRHLNTAPAAPAAPATPSAHAPIASASSCSSNNGSSGYWYEKIEHNGQSSFLSSE
YKDSYKVFRNVVSDYQADNTGNQDAAPAIQRAIEAGASNGPSRNSKSMGTTGQPAVVYLP
GGTYLLQTSLQLFTGTVLVGDPSNPPVLKAASGYSLDHIIYAKDPNHEGTNNFYIGIKNI
VLDSTGVDSAKSLSLLDWTVSQATQLANVAFHMPTGSKHTGLTTQYDYNSNIIVNDLSFS
GGGVGMKLSGQQWVFKNLTFTGTTIGVVAGATDIVFLGCQFQQGGIGINASETSGSLTVI
DSSASGLDTFITSGDSGGAGNAIVLENVQSSGVTVSLGGKAVLTGGVSDTWVHGTMYNSG
STNKERVDGKIVVTNRASSLLSGNKYYTVSPPTYQEYRSNKVLNIKSVSSSPVYGDGQTD
DTANINKILSENKDCKVIYFPAGTYIVTDTIFVPIGTRIIGDAFASTISAVGNNFKDEAF
VRVMIRVGYPGDIGVAQISDMVLTVGDILPGCQLMEVNIAGKNPGDVGFWNVHFRIGGGV
GSRVHSDCTSSPDSCKAAYGLLHLTGTSSAYIENMWGWTADHDLDGSSTQTISTGRGLLV
EAVAATWLIGTGFEHHTLYQYNFEHAHNVLATMQQSETPYWQGVGSTLAPAPWGDHLSSS
DPDFSWCAGDDATCRMALFERINGASNLFLYGGCNWAFFNNNGGCNGKCQKNAVQIIESS
ALYLYGTNTKSTANMILEGSTTIATEDDNAGGWGGVIAAFLYKT

Enzyme Prediction     

No EC number prediction in KAB8207379.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	93	820	2.5e-226	0.9918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.10e-56	128	349	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.38e-08	475	535	11	74	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	0.001	131	241	84	201	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46035.1|GH55	0.0	1	824	1	830
QMW33981.1|GH55	0.0	1	824	1	830
UDD62843.1|GH55	0.0	1	824	1	830
QRD94287.1|GH55	0.0	32	824	1	787
BAE63373.1|GH55	0.0	20	824	27	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	2.29e-105	103	820	26	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	1.55e-94	101	820	4	753	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	3.33e-104	97	820	37	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	4.34e-97	135	820	64	760	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1
sp|P49426|EXG1_COCCA	2.92e-96	102	786	47	742	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999740	CS pos: 21-22. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in KAB8207379.1.