CAZyme Information: KAB8207253.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8207253.1
• CAZy Family: GH3
• CAZyme Description: glycoside hydrolase superfamily

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	ML734958|CGC5	35995.49	4.7832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734958:381717-382802(+)

Full Sequence      

MKWLICVLVVLLLSLQVKALPHESLDQSDPAPPPGDAGKLEIPINDDPNNLPPLLPIPDP
ATPDLVPSLPIEGGYGISYAPYNDDGTCRSLDGINEDLDKISEHYSYVRIYGVDCDQTQN
IVSAARQRNLRVFAGLFDLQNFPNSLDQIIWAAAGDWSTFHTISIGNELVNKGQNPQDVV
NAVHTARAKLRAAGYQGPVVTVDTFSVLLKHPQLCEASDYCAANCHAFFDANQIPDSAGK
YALEQANRISAAAGGKRTVIAESGWPYRGQANGKAVPSAWNQAIALYALGYSFRDRKDDM
VLFSAFDDLWKQDGPGTHDAEKFWGIMRR

Enzyme Prediction     

No EC number prediction in KAB8207253.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	97	328	4.7e-23	0.8971061093247589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	7.90e-71	76	327	47	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89175.1|GH17	6.71e-237	1	329	1	329
UCK57248.1|GH17	6.71e-237	1	329	1	329
QMW24913.1|GH17	7.83e-233	1	329	1	326
QMW36913.1|GH17	7.83e-233	1	329	1	326
BAE54672.1|GH17	4.41e-218	26	329	97	400

PDB Hits     

KAB8207253.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	7.69e-66	73	326	125	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	4.27e-61	72	327	134	386	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	2.19e-60	72	327	131	383	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	1.33e-39	67	327	301	561	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|A1DBG6|BTGE_NEOFI	2.22e-39	71	327	292	548	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000183	0.999828	CS pos: 19-20. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in KAB8207253.1.