CAZyme Information: KAB8206558.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8206558.1
• CAZy Family: GH28
• CAZyme Description: nucleotide-diphospho-sugar transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	ML734962|CGC3	40839.65	5.5925

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734962:90451-91598(-)

Full Sequence      

MIADSPFGCLSRRRIQLILGISVVLVLLSYPFRSSIVPSVVPASSPPIARALPARTLLSR
PLSRDGTTIPKIIHQTWFPAGSNMSERAQEWVHGMRAQNSDWEYVLWDDETNRMLVEQYF
PWFLQTYDSLPKEILRADVVRNLYMYLFGGMYADVDTEALRPVAPLFAGHETALAAHQDI
LSSAPSFQRATVQRAFLGRMARTVDILSSAAVPNGWMASPAGHPFWLLPVLNVIEHPEGT
GDGSVEGLTGPGALSLMIKKYWDNFKDNSLREHACKTIQRRQSSWQLFCDESELAMGAHM
QDALVLLPEKQIYPFSWVDDANNASVCQAAWENPTFDPEECKRLMEVEAWPSYFITYCTH
SW

Enzyme Prediction     

No EC number prediction in KAB8206558.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	88	166	1.2e-17	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.56e-26	67	272	80	250	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.74e-14	98	166	14	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD65556.1|GT32	1.88e-271	1	362	1	362
QMW48351.1|GT32	7.64e-271	1	362	1	362
QRD92713.1|GT32	3.11e-270	1	362	1	362
QMW36295.1|GT32	3.11e-270	1	362	1	362
BCS10897.1|GT32	7.45e-160	1	362	2	371

PDB Hits     

KAB8206558.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	4.01e-20	63	233	51	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	9.14e-18	69	268	62	232	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.62e-15	69	271	55	228	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.05e-15	69	261	82	243	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	5.97e-15	69	261	64	229	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996131	0.003889

TMHMM  Annotations     

There is no transmembrane helices in KAB8206558.1.