CAZyme Information: KAB8205974.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8205974.1
• CAZy Family: GH2
• CAZyme Description: cytochrome P450

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	ML734966|CGC5	85980.15	6.1456

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734966:22492-28006(-)

Full Sequence      

MASAVPIIYMLGMAIYNVYFHPLNRFPGPVSHAISRIPYFYRSVRGTLPFDMLKLHERYG
DIVRIAPDELAFSHPDAWKDIFSHKNGEPEMAKATWFYRPLDDPLHIVNEDTDEHRRLVI
SDWYNFTTFDIIGDLAFGEPFGCLEGCNYDQWIKGIFEGAYLGSFMQALSFVPWLKSTLL
LLVPKSMQEAHQRHKELTTAKMLRRAAITEKRPDLIEGLLRNKDELKLGIDKLIANAEIL
IIGGSETTASLLSGVTYLLLQNPNAYETLKHEVRSKFNTQEEINLISVNKLSYMLACLDE
ALRMYPPIANGLPRVCPKDGSRILGEYIPGKPTPRLIERSTNINSGLISDRRLLLLPQMV
KCSSTYHKPSQYCRTEASYPGSNNIDGGVLVALSGLDSYKVHSDTIDVGPGLAWYDVYKA
LAPYGRAAIGGRMKTIGVPGLTLIGGFHYFNNKYGYAMDNVVSYDVVLGNGTQVVASNVS
HPDLFWALKGGANNYGIVTKFTLNTFDVPQVTTSIQVFNETYFPSFFEAMCHSASLDETD
PIAAGMIATVTYNATTKVASASLLGVQEGVSNPPSQFANFTKIPATERINNVTTLSQWAE
NLDSPKQMFRVMFSHKTMKPDPDMLYSIYKAWKAAVDDISDVEGLYPTFVLNEITPSSLR
VAQTNGVGNVWGLEPEPLMIWQFSTGWANAQDDLRVESWARQLTEHLHSINQEKGLASEF
IYMGDAGEWQDPYAGFPPENVQRMRDIRTAYDPKGIFSTLSWGGFKLGL

Enzyme Prediction     

No EC number prediction in KAB8205974.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	379	758	2.7e-46	0.8799126637554585

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410681	CYP60B-like	1.33e-120	60	331	1	316	cytochrome P450 family 60, subfamily B and similar cytochrome P450s. This family is composed of fungal cytochrome P450s including: Aspergillus nidulans cytochrome P450 60B (CYP60B), also called versicolorin B desaturase, which catalyzes the conversion of versicolorin B to versicolorin A during sterigmatocystin biosynthesis; Fusarium sporotrichioides cytochrome P450 65A1 (CYP65A1), also called isotrichodermin C-15 hydroxylase, which catalyzes the hydroxylation at C-15 of isotricodermin in trichothecene biosynthesis; and Penicillium aethiopicum P450 monooxygenase vrtK, also called viridicatumtoxin synthesis protein K, which catalyzes the spirocyclization of the geranyl moiety of previridicatumtoxin to produce viridicatumtoxin, a tetracycline-like fungal meroterpenoid. The CYP60B-like family belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410684	CYP67-like	7.18e-60	60	330	1	315	cytochrome P450 family 67 and similar cytochrome P450s. This subfamily includes Uromyces viciae-fabae cytochrome P450 67 (CYP67), also called planta-induced rust protein 16, Cystobasidium minutum (Rhodotorula minuta) cytochrome P450rm, and other fungal cytochrome P450s. P450rm catalyzes the formation of isobutene and 4-hydroxylation of benzoate. The gene encoding CYP67 is a planta-induced gene that is expressed in haustoria and rust-infected leaves. The CYP67-like subfamily belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410683	CYP57A1-like	3.14e-45	60	330	1	323	cytochrome P450 family 57, subfamily A, polypeptide 1 and similar cytochrome P450s. This family is composed of fungal cytochrome P450s including: Nectria haematococca cytochrome P450 57A1 (CYP57A1), also called pisatin demethylase, which detoxifies the phytoalexin pisatin; Penicillium aethiopicum P450 monooxygenase gsfF, also called griseofulvin synthesis protein F, which catalyzes the coupling of orcinol and phloroglucinol rings in griseophenone B to form desmethyl-dehydrogriseofulvin A during the biosynthesis of griseofulvin, a spirocyclic fungal natural product used to treat dermatophyte infections; and Penicillium aethiopicum P450 monooxygenase vrtE, also called viridicatumtoxin synthesis protein E, which catalyzes hydroxylation at C5 of the polyketide backbone during the biosynthesis of viridicatumtoxin, a tetracycline-like fungal meroterpenoid. The CYP57A1-like family belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.
410682	CYP_fungal	1.36e-31	60	330	1	320	unknown subfamily of fungal cytochrome P450s. This subfamily is composed of uncharacterized fungal cytochrome P450s. Cytochrome P450 (P450, CYP) is a large superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop. Their monooxygenase activity relies on the reductive scission of molecular oxygen bound to the P450 heme iron, and the delivery of two electrons to the heme iron during the catalytic cycle.
410685	CYP58-like	5.08e-31	60	334	1	326	cytochrome P450 family 58-like fungal cytochrome P450s. This group includes Fusarium sporotrichioides cytochrome P450 58 (CYP58, also known as Tri4 and trichodiene oxygenase), and similar fungal proteins. CYP58 catalyzes the oxygenation of trichodiene during the biosynthesis of trichothecenes, which are sesquiterpenoid toxins that act by inhibiting protein biosynthesis. The CYP58-like subfamily belongs to the large cytochrome P450 (P450, CYP) superfamily of heme-containing proteins that catalyze a variety of oxidative reactions of a large number of structurally different endogenous and exogenous compounds in organisms from all major domains of life. CYPs bind their diverse ligands in a buried, hydrophobic active site, which is accessed through a substrate access channel formed by two flexible helices and their connecting loop.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA66095.1|GT34	2.30e-22	9	333	388	770
QRD93627.1|AA7	7.57e-18	359	517	63	223
UDD63515.1|AA7	7.57e-18	359	517	63	223
QMW46638.1|AA7	2.37e-17	359	517	63	223
AEO62186.1|AA7	3.36e-16	381	517	98	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	4.87e-17	381	517	100	239	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6FYE_A	5.31e-16	378	523	79	221	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
2BVF_A	6.87e-16	386	510	81	207	Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVF_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVG_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVH_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans]
6FYD_A	1.24e-15	378	523	79	221	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	2.19e-15	378	523	79	221	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1E1FFM3|PRHB_PENBI	1.08e-93	7	333	12	381	Cytochrome P450 monooxygenase prhB OS=Penicillium brasilianum OX=104259 GN=prhB PE=3 SV=1
sp|A0A3Q9FEJ4|ASTA_TALWO	3.41e-75	3	331	12	381	Cytochrome P450 monooxygenase astA OS=Talaromyces wortmannii OX=28567 GN=astA PE=1 SV=1
sp|A0A2Z4HPZ7|EFUB_HORCR	9.07e-67	4	329	22	395	Cytochrome P450 monooxygenase efuB OS=Hormonema carpetanum OX=284138 GN=efuB PE=3 SV=1
sp|A0A179H0I7|LCSI_PURLI	2.22e-65	2	330	27	403	Cytochrome P450 monooxygenase lcsI OS=Purpureocillium lilacinum OX=33203 GN=lcsI PE=2 SV=1
sp|Q2UEL1|ASTJ_ASPOR	2.92e-65	6	330	16	384	Cytochrome P450 monooxygenase astJ OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=astJ PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999161	0.000842

TMHMM  Annotations     

There is no transmembrane helices in KAB8205974.1.