CAZyme Information: KAB8205788.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8205788.1
• CAZy Family: GT90
• CAZyme Description: Glycos_transf_1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A5N6DKY7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667		75818.77	6.2544

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734968:261151-263479(-)

Full Sequence      

MSEQQQRRRRERDINAVISWSGRSLTTIYAGISILHRDYEDSRAAIAFRTSAYLFDYIVF
DLPAESSNTPAHTICNQIISELRTYSEKYKVKIVGLAMPLSLADKYPPLCPQLWRELDIL
PLVLEHKERARADADQGELATFTSWNAKELDEQADSMVRKCMRSFGVGHVLQGEIGLGSL
VGVDRNFRVRLADLDDYQETVNTRTWSIAQHYAEELKRRNVKIAFFSLSSHGRPDIRTRH
SLVRFLHCLGVNVQWYVPKPRPGINGIIRKMQDSLEGLGARDDSITIDEEMCILQWVYEN
ARRYWLCEDDPLQARSKGGADIVVIDDVPLTPAALLSKQTDPGRPVIFENRLQVQRSALQ
DAGSFSTRLWDFLRERLKHVDLVVSQAPNELLPDIIPQKKVGYIPVSVDQLDGFNKCMSD
FDLTFYGREFNTLCRSFETPTLNYPNEEYILHLSQFRNLDETITVLNAYQKFRSHCMDAG
MNNLFPKLLIYHYGPSRSSRSTLIYDAILSYIETDMPCLKSCIYVMQIGPPDQLWNTLLT
KAKVVIELSMSEGIPAMLLAAVQKGKPIITVKEIGQFSFTKGINNILFCEKGDADIVARL
LRDLWTDPQLSELLLPGPRRLRDEYTTVGNAVNWLFLAAEMSREGNVVEPDGRSIYELAG
QGAGLCA

Enzyme Prediction     

No EC number prediction in KAB8205788.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	5.29e-104	222	640	1	377	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
223515	RfaB	5.18e-04	368	626	142	362	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW47856.1|GT4	0.0	1	667	1	667
QMW35794.1|GT4	0.0	1	667	1	667
BAE65846.1|GT4	0.0	1	667	1	669
QRD93295.1|GT4	0.0	1	667	1	674
UDD64944.1|GT4	0.0	1	667	1	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X6Q_A	7.99e-09	194	602	16	378	Crystal structure of trehalose synthase TreT from P.horikoshi [Pyrococcus horikoshii],2X6Q_B Crystal structure of trehalose synthase TreT from P.horikoshi [Pyrococcus horikoshii],2X6R_A Crystal structure of trehalose synthase TreT from P.horikoshi produced by soaking in trehalose [Pyrococcus horikoshii],2X6R_B Crystal structure of trehalose synthase TreT from P.horikoshi produced by soaking in trehalose [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O75003|TREPH_GRIFR	7.22e-89	24	658	35	707	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|A6YRN9|TREPH_PLEPU	4.70e-86	24	658	39	714	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|Q9UV63|TREPH_PLESA	9.19e-79	24	658	39	726	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1
sp|O58762|TRET_PYRHO	9.52e-08	194	579	15	351	Trehalose synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=treT PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000076	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAB8205788.1.