CAZyme Information: KAB8205458.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8205458.1
• CAZy Family: GH16
• CAZyme Description: Fn3_like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A5N6DK17]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1120		123263.82	5.5486

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734970:95371-99396(+)

Full Sequence      

MGSHGEYSFKDAIADTKAGQPLAETSQILLSQLTKEERLSLLDGDVEFWPGLRSILCDRY
NRTPYVHGAISRKQIPGIKFTDGPRGVVMGSSTAFPVPMARGATWDVELERRVGDAIGRE
AKAQGANYFAGVCVNLPRHPAWGRIQETYGEDPLLLGEFGLALTQSVQKHVMACVKHYAL
NSMENARFRVDVSVEEAVLHEVYLAHFRRIVEGGVAAVMSSYNSVNGEWAGQNRHLLTEI
LRDQWGFDGLVMSDFIFGLRDAAASVKNGLDIEAPFRQQRARKLPQALESGDLDWKYVDR
ACERILRKQIEFTVRTEDSQPSPDVVFCDEHRALAREVAARSMVLLKNDTVDGKVVLPLQ
AESLSRVAVVGRLANIANTGDKGSSQVFPPGVVTPLDGIKAALPGTEVLFADSVAKAEQL
ASQVDVVICIVGYTHEDEGEYVVPALQDNPALRDTLPPATTAEERETLDIFEGNSDKGGN
GGIKAGAGGDRTSLRLRDEDEKLISAVTAHNPRTIVSVITAGAVIMESWKDKVPALLISW
YSGSEGGHGLGDVLLGKVDASGRLPFSIPTIEAHLPFFNRNAAEIYYDRWFGQHMLDKLG
VKAGFPFGFGLSYTTFAVDSIVAESVDKESIQVAVNVQNTGRRPGRFIAQVYAVTSIPDF
PTRVLLGFAPVDLDVGQRTTMRFLAATRPIQQWKAGTFTLRTNQIQLEVASFAGDGGAPV
PALVPFPTLNPNNDSSTAYTVARETQRPESLLPENLDAVLKWPILQDIHYQVNQSPHILS
PSSDHDSPAQPSLDGDELNLGITNAYLDNFFAHVHPKNPVLDEPYIRRLVRKVSLEGPSW
DSESCLALLVCANGAITGPLSAPSISAEDLRIGCMPEFQPKRASTGHHGSLPDFGTRISL
EPPQRFPTLPLTDDEEILRAWYFYLSEISLWRLETEIRKDMTARLSEPYNNTLNGLADIS
EIYQQQLVACLHSLPSTVSIFDPPRQTPETDVLRFILQGRSTCFNELITWPYIAYAVNDV
PLGHTAQGWVSKGLQTHLERLEVNQAGFYHRHHGTWLMIRTSARSACILLAVARSRMRDL
LPGGWKEAVEATVKMLDFWQADVEGLAVLAGLLRHLVSYT

Enzyme Prediction     

No EC number prediction in KAB8205458.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	274	4.7e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.03e-69	71	683	100	723	beta-glucosidase BglX.
224389	BglX	5.28e-62	69	402	54	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.97e-48	4	684	37	741	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.11e-45	343	613	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.70e-42	71	307	62	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW38593.1|GH3	0.0	1	1119	1	1241
QMW26514.1|GH3	0.0	1	1119	1	1241
BAE55411.1|GH3	0.0	1	718	1	718
UCK59088.1|GH3	0.0	1	718	1	718
QRD87369.1|GH3	0.0	1	718	1	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	6.06e-73	29	683	8	625	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.01e-67	29	652	7	638	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	5.76e-67	22	718	1	669	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X42_A	1.17e-66	29	652	7	638	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	9.28e-62	14	703	43	805	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	3.12e-72	29	683	8	625	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|P27034|BGLS_RHIRD	5.78e-71	29	725	5	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A7LXS8|BGH3A_BACO1	1.50e-70	24	715	19	736	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|Q5BFG8|BGLB_EMENI	1.77e-67	29	715	14	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q5BB53|BGLI_EMENI	1.32e-60	30	693	10	797	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000007

TMHMM  Annotations     

There is no transmembrane helices in KAB8205458.1.