CAZyme Information: KAB8205150.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8205150.1
• CAZy Family: GH16
• CAZyme Description: glycosyl hydrolases family 31-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745		83974.94	5.8797

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734973:206687-208924(+)

Full Sequence      

MHRWLVALTVCAAQLVLATPIQTRESDYFLPNSTGFRMQHGFETILVQPFGHDGFRVRAW
PFRPPTGHEISFIYDPPLEGFENGQAHGLNFDTAFNGNHTVAIRNGNTIVRTSGWGGNPG
GYRLAFYRIEQDGSETLLTNEYAPLKSINPRYYSWNGPGSEFSAEFSFSTTPDEQFYGTG
TQQDHLVNKKGTVIDLINFNTHIPTPVFMSNKGYAFIWNMPAQGRMEFGQLRTKLTAEST
TVVDYVIVATTPGDYDTLQKRLSALTGRAPTPPDFSLGYIQSKLRYENQTELELLAQKFK
DNNVPVGMFVIDYQSWRNQGDWGLDPALWPDVAAMAKKVKDLTGAEIMASLWPSVSDASD
NYLELQANGYLSATRDGPGTTDSWNGSYIRNVDSTNPGARKFIWSTLKRNYYDKGIKNFW
IDQADGGALGEAYENNGQSTYLQSIPFALPNVLYAAGTQQSAGKYYPWAHQLAIEEGFRN
VTDSKEGEACDHISLSRSGYIGSQRFCSMIWSGDTSSVWETLGLQIASGLSAAATGWGWW
TMDAGGFQPDPTVPWSANIDTPEYRELYVRWLQWATFVPFMRTHGQRVCDNQDAYTCNNE
PWSFGEKNTPIILSYIHLRYQLASYLRALFDQFHKTGRMIMRPLYMDFEKTDPKVAQWTQ
ANNNVTTQQYMFGPRLLVSPITTPNVTEWSVYLPQTGQNGTKPWTYWWTNQTYAGGQTVT
VPAPVEHIPLFHLGKREDILSGNVF

Enzyme Prediction     

EC	3.2.1.177:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	254	732	2e-115	0.9672131147540983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269877	GH31_xylosidase_XylS	2.47e-125	267	619	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
395838	Glyco_hydro_31	8.00e-111	245	731	1	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	1.14e-108	167	731	146	663	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269889	GH31_GANC_GANAB_alpha	5.67e-51	267	734	1	422	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
236691	PRK10426	2.09e-45	172	731	80	616	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83681.1|GH31	0.0	1	745	5	749
QMW32240.1|GH31	0.0	1	745	5	749
UDD57197.1|GH31	0.0	1	745	5	749
QMW44267.1|GH31	0.0	1	745	5	749
BAE62323.1|GH31	0.0	1	745	5	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	0.0	28	745	2	718	Xylosidase from Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
7KMP_A	4.43e-57	235	731	398	858	Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
5JOU_A	9.20e-54	237	731	369	837	Bacteroides ovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
2XVG_A	8.47e-50	230	731	390	867	crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6JR6_A	4.57e-36	173	731	155	681	Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QTU5|XYLA_ASPNC	0.0	15	745	7	736	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
sp|Q01336|YCR2_PSEVU	2.05e-74	43	587	18	525	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
sp|Q9P999|XYLS_SACS2	5.97e-73	132	744	70	629	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
sp|A7LXT0|GH31A_BACO1	4.71e-53	237	731	368	836	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	5.02e-44	174	744	147	679	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999772	CS pos: 18-19. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in KAB8205150.1.