CAZyme Information: KAB8204807.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8204807.1
• CAZy Family: GH13|GH13
• CAZyme Description: glycoside hydrolase superfamily

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
989	ML734976|CGC2	110402.35	4.8048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734976:138861-142216(+)

Full Sequence      

MRLWHIFSSAVAIACLATAQDWPLHDNGLNQVVQWDHYSVIVNGERLFLWSGELHLWRIP
VPELWRDILEKIKAAGFNGIGLYEHWGWHAPNNETLDFETGAHNFAQAFEIAKELGLYII
YRPGPYSNAEANGGGFPGWLTTGEYGALRDDSEKYTRAWTRYSGAVAEYVRPYLITNGGP
IIMWQIENEYGVQWLDPDLKTPNHTAINYMELLEQKHRGWDIDVPFTANNPSMYTRSWSK
DYGNVGGEVDLYGLDHYPACWTCNLAQCLSVNGQVEPYTIFDYYTHFNGVSRTQPSFLME
FQGGSFNPWDGPEGGCKENMGPDWVNLFFRHNLAQKVTAVNIYMLYGGTNWGNIGFPEVG
TSYDYSAPIHETRLIGDKYNEAKLFGIFMRVARDFSKVERVGNSTQYATDQDIFTTELRN
PDTGTAFYVTRHEYSPSTEVTKFRLHVSTDIGNLTVPTKGSITINGTESKVLVTDFGIGS
SGKKITYTTLEILTVSDLGDRQVIVFWAPEGEEGEFLLKDSKSGKIMTGNADNKTLTTTR
YGVVTSVGAGNEMTVIDYNHDVQAVVVDRQSAYKFWAPTLNNSPLAWENSTVLVHGPYLV
RTAEIEGDTIYITGDWDEETHIEIWAPKNVNNVSFNGSKLKITKSKYGTLVGTLPAPEVT
ADSLVAELPPLTNWKVAENLPERLVDYDDSKWTNANHMTTPHFVPPDTYPVLFADEYGYQ
AGNILWRGRFNASEGSMPSGAYLRVIGGLAIGFSAYVNGEFLGSWLGSMANKTGELEVSF
KDVKLNTGDDNVLFVIQDTMGKEQRDAAPDPRGILNATLISADGSPTNFTSWKVAGNAGG
NHLLEPVRGTYNEGGLHAERLGWHLPGFDDNDWESGVPADGFTGADARFYRTVLSTEKKA
KLRAQLYVNGYQFAKTLPYISNETTFPVFPGILDYNGNNTIGLSVWTMDEAGGRVDVAWK
VMGVHRSAFDPLFDGEYLRPGWKDRSQYA

Enzyme Prediction     

EC	3.2.1.-:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	41	384	2.6e-79	0.9804560260586319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	4.58e-82	39	384	1	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	5.46e-59	396	574	2	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	1.05e-43	394	575	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	3.52e-30	33	371	30	323	beta-galactosidase; Provisional
404273	BetaGal_dom3	5.32e-27	589	651	3	65	Beta-galactosidase, domain 3. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW34558.1|GH35	0.0	1	989	1	1005
QRD93645.1|GH35	0.0	1	989	1	974
QMW46613.1|GH35	0.0	179	989	256	1082
UDD63503.1|GH35	0.0	210	989	1	796
QKD61358.1|GH35	0.0	79	989	502	1444

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IFP_A	4.26e-177	8	956	4	975	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	1.18e-176	8	956	4	975	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
1TG7_A	3.09e-171	29	956	2	939	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
4IUG_A	5.04e-163	23	955	36	972	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	1.62e-159	29	955	22	970	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2W791|BGALB_PYRTR	0.0	18	989	31	1009	Probable beta-galactosidase B OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) OX=426418 GN=lacB PE=3 SV=1
sp|B8NKI4|BGALB_ASPFN	0.0	8	989	15	1020	Probable beta-galactosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacB PE=3 SV=2
sp|B6QLF0|BGALB_TALMQ	0.0	19	989	21	1009	Probable beta-galactosidase B OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) OX=441960 GN=lacB PE=3 SV=1
sp|Q0CMF3|BGALB_ASPTN	0.0	6	989	8	1022	Probable beta-galactosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=lacB PE=3 SV=2
sp|B0XNY2|BGALB_ASPFC	0.0	21	989	28	1015	Probable beta-galactosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999671	CS pos: 19-20. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in KAB8204807.1.