CAZyme Information: KAB8204746.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8204746.1
• CAZy Family: GH134
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452		49680.09	8.3501

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734977:242116-243583(+)

Full Sequence      

MAAGLALARPNLLNPNNPIRSLSLAFWLWKALLFLVIIGCPGPGYDTSTGLLPYQESAAS
GAKLEAIRHAPFSFPLKLVRWDSIYFVHIVRDHYVFEQEWAFGYGYTRILSFLTSVLPQF
SGLDGVARVALVAIALSHIAHYFSVLALYRLSINIFGHDNTSGALISFLSAALHIICPAG
AFLSAPYGESLFSFLNITGYFLYSSSLLDANAGKRASSDAKLLLAAALFSIATAVRSNGI
LSGTLFAFDALLQLRKIFTQGISGDILLRLGVIVVGGCVIALGLIVPQWIAYTTFCMSDE
PLRPWCEQLIPSIYGWVQVHYWNVGFLRYWTLSNLPLFILAFPMLFLMCRSSIWALNTAW
PSDTATSVLTRLAAPNGLLAVMAFTSYHVQIINRISSGYPLWYWYIICQVFTHVADSGSV
DKHSQTFSIAIQGMVIYAIVQAVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in KAB8204746.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	25	452	6.7e-108	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	6.53e-33	78	452	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	4.45e-17	80	452	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40534.1|GT76	0.0	1	452	1	452
QRD82967.1|GT76	0.0	1	452	1	452
QMW28463.1|GT76	0.0	1	452	1	452
BAE58188.1|GT76	1.28e-301	1	452	1	434
UDD56494.1|GT76	1.23e-230	113	452	11	350

PDB Hits     

KAB8204746.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	2.28e-302	1	452	1	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	6.93e-157	12	452	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	2.30e-87	16	452	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	4.44e-84	11	452	2	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.31e-44	21	452	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.949480	0.050529

TMHMM  Annotations     

Start	End
21	43
129	151
163	185
224	246
267	289
326	348
391	413
428	450