CAZyme Information: KAB8204698.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8204698.1
• CAZy Family: GH134
• CAZyme Description: galactosyl transferase GMA12/MNN10 family-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	ML734977|CGC1	36065.21	9.2359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734977:89080-90181(+)

Full Sequence      

MQFALPPRRNVNAPLYGRSSRLSLQRRKQLKAVAILVFALVVIYFLLSQLFYSSTGTPAA
PAGTSSLVIVTVLDRARWSADYIQKITKNREEYAKQHGYANFFANLSDYETTLESAPRSW
GVVPAVRHAMATHPYSKHFFYLDANALIMNPSKSLESHLLEKSRLDSLMLKDVPVVPPDS
IIKTFSHLQPQDVDLILSTDSESLSSGSFVIKQGEFAQTFLDIWFDPLYRSYNFAKAETH
ALDHILQWHPTILAKLALVPQRIINAYSKDSSGTGADGNYKDGDLVIRFFGCDTDTKRNC
EKEMEPYYRLWSKKLKND

Enzyme Prediction     

No EC number prediction in KAB8204698.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	66	297	8.3e-78	0.9715447154471545

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.03e-71	63	292	1	232	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	6.17e-04	88	148	155	211	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE58231.1|GT34	4.66e-227	1	318	1	318
QMW40577.1|GT34	4.66e-227	1	318	1	318
QRD83015.1|GT34	4.66e-227	1	318	1	318
QMW28506.1|GT34	4.66e-227	1	318	1	318
UDD56546.1|GT34	4.66e-227	1	318	1	318

PDB Hits     

KAB8204698.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94622|YBKD_SCHPO	2.62e-40	82	318	123	357	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|O13640|YGWH_SCHPO	3.62e-40	21	309	5	308	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|Q09174|GMA12_SCHPO	2.21e-35	82	318	123	357	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P46985|MNN11_YEAST	3.47e-32	67	309	160	417	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|Q10359|GMH3_SCHPO	7.80e-30	47	307	67	327	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999974	0.000016

TMHMM  Annotations     

Start	End
30	52