CAZyme Information: KAB8204384.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8204384.1
• CAZy Family: GH13
• CAZyme Description: chitin synthase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
871		98985.19	8.5116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734980:37042-41924(+)

Full Sequence      

MADNMMDVCHGFPDACVSVDPTSMVWKSFNHTKHSLSPTFPRIFVTVTSRKYLTSQGDRV
SPVEGGSLLEILTGALLRRKRWPDTVSFSVLACSDLGNQINQYTPENLLRIVRHWEKVVR
LLRGMIAKTDYIMENTRSLCCILAIRNAIQPKYRDAGEGFTEEFTHLRYTAATCDPDEFT
LRNGYNLRPSMYNRSTELLIAITYYNEDKVLTARTLHGVMQNIREIVNLKKTEFWNKGGP
AWQKIVICLIFDGIDPCDKNTLDVLATVGVYQDGIMKHDVDDRETVAHIFEYTTQLSITP
SQQLIRPHGDEPTTLPPVQTIFCLKQKNSKKINSHRWLFNAFGRLLNPEVVILIDAGTKP
GHKSLLSLWEAFYNNKNLGGACGEIHALLGQRWEKLLNPLVAAQNFEYKISNILDKPLES
AFGYVSVLPGAFSAYRYRAIMGRPLEQYFHGDHTLSQKLGKKGIEGMDIFKKNMFLAEDR
ILCFELVAKAGSRWTLTYVKASKGETDVPEGAAEFLSQRRRWLNGSFAASLYSVMHFNRI
YKSGHNILRLVALHVQLLYNICQLIMTWFSLASYWLTNSVIMDIVGTPSATNKNKGWPFG
NDATPVVNNFLKITYLVFLMLQYILALGNRPKGSKVAYTLSFIYFSIVQLYILVLSFYLV
AQAFSGRNLDLNLDDGVAGFIGSFFTSTSGLVLIALVSTYGIYFLSSILYLDPWHMLTSS
WAYFLGMPSSINVLMVYAFCNWHDVSWGTKGSDQAGSLPSAQTKKADAKTNFVEELDKPQ
ADIDTQFEFTVRRALSPWHPPVEKEDANLDDSYKRFRTNLVLLWVLSNSFLALYYSLGYF
CAVGFPVYRGFMVFRQDWGVVLFFETLIWIF

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	204	372	3.7e-69	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	5.54e-94	204	372	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.52e-92	200	529	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	2.42e-23	161	203	29	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	1.51e-21	303	663	100	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	4.89e-16	349	748	203	490	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW37686.1|GT2	0.0	113	833	114	826
UCK58054.1|GT2	0.0	113	833	110	822
QRD88403.1|GT2	0.0	113	833	133	845
QMW25602.1|GT2	0.0	113	833	114	826
BCS00643.1|GT2	0.0	113	833	101	813

PDB Hits     

KAB8204384.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92197|CHSC_ASPFU	0.0	113	833	121	835	Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsC PE=3 SV=2
sp|P30602|CHS3_EXODE	0.0	111	832	130	849	Chitin synthase 3 OS=Exophiala dermatitidis OX=5970 GN=CHS3 PE=3 SV=2
sp|P29070|CHS1_NEUCR	0.0	113	832	142	858	Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-1 PE=3 SV=2
sp|Q00757|CHSB_EMENI	0.0	113	832	144	857	Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsB PE=2 SV=2
sp|P54267|CHSG_ASPFU	0.0	113	832	139	852	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

Start	End
564	586
606	628
638	660
681	703
718	740
820	842