CAZyme Information: KAB8203892.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8203892.1
• CAZy Family: GH11
• CAZyme Description: glycosyl transferase family 90-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		53442.69	7.0551

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734986:190078-191541(+)

Full Sequence      

MAIPSCSRWRLRPIGLLYLFYLVGFMSFACIVAIWYGVNSDRDYIHPLLTQLIPAGHCAC
QTSTTFQCSTCLSCSEHSLVPQLTSAPKWEFNPDRDANNEGLSTPQCKAAFPGLYEDIFR
AESFWRSQGALATEDLDRIPLGFGMVRAFISRGELYVVAARAKQEDHRRKIVAALSSIHR
ALVAESDRATRRDIEFVFSVEDKVEDVTSSDNPVWVLARSAAEQGVWLMPDFGFWAWDNP
RNSIGPFDQVVERVKRADIPWSQKTPQLVWRGKPSFAPKLRRALMDAARDKPWGDVKQVN
WFERTNIMSMEDHCRYMFIAHVEGRSYSASLKYRQACNSVIVAHKLQYIQHHHYLLVPDG
PNQNYIEVERDFSDLESKIEPLLDDPSTAQRIANNSVRTFRERYLTKAAEACYWRQLFEG
YGHVWNSSVPVWSDVYQRERGLRYESFILLDSQMMFDFSATGGMP

Enzyme Prediction     

No EC number prediction in KAB8203892.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	193	423	1.2e-21	0.968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.20e-20	193	422	4	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.25e-19	103	422	2	320	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD90629.1|GT0	0.0	1	465	112	576
QMW31614.1|GT0	0.0	1	465	1	465
UDD60541.1|GT0	0.0	1	465	1	465
BCS06430.1|GT0	3.24e-283	1	460	1	460
BCR93809.1|GT0	3.24e-283	1	460	1	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	6.93e-07	189	421	126	375	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	1.65e-08	209	422	158	386	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	3.64e-06	189	421	138	387	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	4.80e-06	189	421	136	385	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000001

TMHMM  Annotations     

Start	End
13	35