CAZyme Information: KAB8203762.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8203762.1
• CAZy Family: GH105
• CAZyme Description: Versicolorin B synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643	ML734987|CGC1	70329.32	4.9214

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734987:74223-76207(+)

Full Sequence      

MGRNWFQVTAMAVVPVVGIMAAVNPTILSSAASSLPSLGAMFTSDDFASQMDGRIQAQGL
LSSHFGMYGWPGQSFDYVIVGGGTAGLAMARRLSQDGTASVAVIEAGGFYETDAGNATEV
PMYLFNYFFDNGKVKNPLFDWYQYTTPQPGLAQREMFYMQGKTLGGSTARGAMLYHRGSK
GAYDMWADHVGDDSYRWDKWLPYFQKSVHFSGPETNPRPANATALNDNTAFTASGGPVHV
GYPFQVNAISSWVDRALAKMGFPEAQGFSNGNLLGRSYITHTINPYTRRRETASSSYLRE
ALMESNNLNIFTRTLVKRVLFDDQNRATGVTVNTDGFEWQIGARKEVILSAGVMRSPQLL
MVSGIGPKDHLEQLGIPVRSDLSGVGQNMQDTIILGPTVPVKVESHSQLMGNKETLPRAI
REYNEQRKGLLTNPGQDYFAFEKHQPGMLKESTAADIDAAFPDDWPTFSYIALDDTFVPQ
YDGKNYFSMSAALMTPFSRGTVTINSNDTANPPIVDPQWLADPRDQEMAVAAFRRCREIV
ASDVMREVVAGPEILPGPQYQTDEEILNYIAETSDAYYAGVGTCAMGKADDPKAVVDSKA
RVLDVKGLRIVDASIFPFAIDGQPMGTVYALAEKIAAEMMAGQ

Enzyme Prediction     

No EC number prediction in KAB8203762.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	73	638	3.5e-176	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.32e-100	73	642	4	533	choline dehydrogenase; Validated
225186	BetA	1.94e-90	74	642	7	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.46e-43	496	635	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.82e-26	153	391	16	215	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.93e-24	62	628	43	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAC49318.1|AA3_2	0.0	1	643	1	643
AAC49319.1|AA3_2	0.0	1	643	1	643
AAS66012.1|AA3_2	0.0	1	643	1	643
BAE59528.1|AA3_2	0.0	1	643	1	643
QMW30456.1|AA3_2	0.0	1	643	1	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.74e-62	72	637	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	8.92e-62	72	637	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	8.92e-62	72	637	5	558	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	1.22e-61	72	637	21	574	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	1.38e-61	72	637	81	634	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M2Y151|VBSA_DOTSN	0.0	12	642	10	646	Versicolorin B synthase OS=Dothistroma septosporum (strain NZE10 / CBS 128990) OX=675120 GN=vbsA PE=2 SV=1
sp|A4UHS8|VBSA_DOTSE	0.0	12	642	10	646	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2
sp|Q12062|AFLK_ASPPU	0.0	1	643	1	643	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|C8VDT4|STCN_EMENI	0.0	6	642	4	638	Versicolorin B synthase stcN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=stcN PE=2 SV=1
sp|A0A075TRK9|PATE_PENEN	1.32e-161	31	639	10	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.982026	0.017993

TMHMM  Annotations     

Start	End
13	35