CAZyme Information: KAB8203292.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8203292.1
• CAZy Family: CE5
• CAZyme Description: nucleotide-diphospho-sugar transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		41459.44	7.5897

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML734993:150355-151425(-)

Full Sequence      

MESLGWLLRRAWCSFITLWNFVWLHPLLSFFTTSLFFLLISLTRSFVEFSNNLKTHSLSL
NNFSPAYVTALNESINLGQPIQFDAADNKTSPTSIPRIIHRTYKTKDIPSHWKGTYESCR
VLNPTYEQYFWTDESSRRFIETHFDWFLPTYDAYPYSIQRADAIRYFILWHYGGVYIDMD
IACRRPLDPLLDFSAWMPKTQPYGVSNDLMASTPGHPFITKLALSLHDHDGFYLSKYITV
FFTTGPMYLSSILTEWFRKVQNGPGEEITMPHSVAILPSMMYDTTAYSFFGHAPGSTWHG
NDVAAVSYVYKHWREFCLGVVALGLLVLTIYILRVRRRRSKYTLILDRQDEEAGHF

Enzyme Prediction     

No EC number prediction in KAB8203292.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	111	191	5.4e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.79e-50	31	313	17	295	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.49e-25	109	194	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88228.1|GT32	1.84e-259	1	354	1	354
QMW37845.1|GT32	1.84e-259	1	354	1	354
QMW25762.1|GT32	1.84e-259	1	354	1	354
BAE56144.1|GT32	5.28e-259	1	354	1	354
UCK58225.1|GT32	5.24e-219	59	354	35	330

PDB Hits     

KAB8203292.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	4.91e-66	94	316	56	272	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	8.65e-64	87	312	47	265	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.84e-62	81	312	68	295	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	4.97e-59	84	339	50	304	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	2.51e-57	77	312	44	273	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998399	0.001614

TMHMM  Annotations     

Start	End
21	43
316	335