CAZyme Information: KAB8202141.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8202141.1
• CAZy Family: AA9
• CAZyme Description: Glycosyltransferase family 32 protein [Source:UniProtKB/TrEMBL;Acc:A0A5N6DAI8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	ML735008|CGC1	47517.27	8.7343

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML735008:5091-6384(-)

Full Sequence      

MAIHPQRQRRLSICGRKLLLLLLAALIYLVLYHLPPPPKTKNNTSSNRKAPKYDVDTTPR
FLHLSSFREDPDSEYEKKVSDALLEIERNALRATNWDTSAEDRIWQVALGKYIERESDSL
EFEHENSEWKYSLVGDKKASKFITEIFSSVPDLKKLYDSYPYHVIRSDLIRYLILWYYGG
FYADMDVYPARAIKGCPALEPLWEDGSKSPNVSLVVGIEIDEPHASPHLMREWRWIRRYQ
LIQYTIYAPRRFSPILREVIVRVMAHTRRQINQSNFLRGPRYKENTILEVTGPGVFTDAV
LDVLSRTLPPTHILVESSVNADADIGDLVSPSTGVTQRRVTWAPFNRIREPVCVDTSEAM
DGKPMGGVCVLPVNVWGNGQRHSGAEGFSSKDACINHRFGRTWRKGWLEYFFG

Enzyme Prediction     

No EC number prediction in KAB8202141.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	120	194	2.1e-18	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	2.08e-12	126	203	15	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	6.29e-08	101	203	83	184	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW25899.1|GT32	1.33e-274	1	413	1	413
QRD88070.1|GT32	1.33e-274	1	413	1	413
QMW37982.1|GT32	1.09e-273	1	413	1	413
UCK58385.1|GT32	1.09e-273	1	413	1	413
BAE56002.1|GT32	2.57e-188	156	413	1	258

PDB Hits     

KAB8202141.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.86e-21	122	404	127	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.89e-19	96	405	104	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	6.73e-15	104	404	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	7.00e-14	122	300	154	320	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	1.45e-06	96	203	65	158	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000003

TMHMM  Annotations     

Start	End
13	35