CAZyme Information: KAB8201874.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8201874.1
• CAZy Family: AA7
• CAZyme Description: GMC oxidoreductase-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	ML735013|CGC1	69636.28	4.8321

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML735013:138419-140588(+)

Full Sequence      

MFSSLRGGQRTTHFWLRALISWTLFSSLVCAETPFSPVMGGLYKELPEGLDEVDVIIAGG
GTAGCVVASRLSDAYPTLSILIVEGGRDNRGLPNVTYPILLLSNILPGNTDTLFYEGIPE
KAVGNRSLVVPSGGVLGGGSSINLLTYSRAQAVDYDQWGVEGWFSKDLVPYLQRLETYKG
EGTPETHGYSGPMLATPGNYTAKASEEGFIKAAAKLGYPEARDIQDLETINATQRNIRYV
SGSKRQDAASNYLHPRLGDGFHPNLYVLTQHQVIRVLFDGNKASGVEFRPNPKFNDGAER
PVQRVSAKKLVVLSSGALGTPLVLERSGVGDPEILGKAGVDVVAEVPGVGAEYQDHQLMT
YAYYSSLLPNETFDAIYSGRTNVDELIKKNDPIIGWTAADVYSKLRPSDEEAKALGSAFE
SAWNRDYKTNPTKPLSMITSLNGFPGDSTSQPEVQYFSCSTFTPYPYSRGHLHITSKDLD
ASLDFATGFFADEDNIDIKKSVWSYKKQREIIRRMDIYRGEFAPLHPAFAADSDAATPSE
PLDGPLPDDVPDIVYTAEDDAVLEQWLRAHVGTTWHSLGTCKMAPKSEGGVVDSNLSVYG
VEKLKIADLSVPPGNVGANTANTAFMIGEKAADIFIQELKG

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	51	639	1.8e-247	0.9966101694915255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.32e-69	52	634	5	530	choline dehydrogenase; Validated
225186	BetA	2.30e-63	52	633	7	531	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.53e-27	466	631	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.72e-22	139	337	30	211	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.57e-10	54	628	57	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82197.1|AA3_3	0.0	1	640	1	640
QMW39845.1|AA3_3	0.0	1	640	1	640
QMW27774.1|AA3_3	0.0	1	640	1	640
UDD55704.1|AA3_3	0.0	1	640	1	640
UDD55705.1|AA3_3	0.0	193	640	1	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	1.65e-135	51	639	5	624	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	3.28e-135	51	639	5	624	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	5.16e-116	51	639	5	636	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
4YNT_A	2.01e-48	54	640	7	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6YS2_AAA	4.25e-45	36	632	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	2.79e-122	51	639	5	636	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	1.36e-119	51	639	5	637	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	3.13e-117	51	639	5	636	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2R038|ALOX2_KOMPC	3.13e-117	51	639	5	636	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|F2QY27|ALOX1_KOMPC	2.65e-115	51	639	5	636	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.567402	0.432590

TMHMM  Annotations     

There is no transmembrane helices in KAB8201874.1.