CAZyme Information: KAB8201699.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8201699.1
• CAZy Family: AA7
• CAZyme Description: pectin lyase fold/virulence factor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		42039.64	5.9476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML735015:4874-6096(+)

Full Sequence      

MRSSGLSLLVGALLASASPLKTSRYACQTALSCPEGTILVSKTDPSAHFTTVQDAILSLP
NDNTTQTILILPGTYKEQVNVTRSGPVTLLGQTDDPNNATKNQVTLTWAQANHDNTGQAV
DNVFSSVLTVAPTLESSYTGSGTTGYPVPEDTPFGNIDFRAYNIDFTNTWRDYSDGPAHA
ISFSRANGGFYHCGFYSYQDTVYVGKLGNAYFHKSIIAGQTDFLYGFGTAWIQSSEILLR
NCGGGITAWKGTNTTFTNNYGVYIVDSTVKAANASIAPDIRGKCALGRPWNSQHRSVFVR
TSEDASIIPAGYIDWIVDGDGRLNKDTVMAEYKAFGPGFNATGRRDGNVTIVMDDKEYAR
YSSPARVFQYPDGRFGNTGWIDLGVDKN

Enzyme Prediction     

No EC number prediction in KAB8201699.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	361	5.7e-61	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	9.53e-29	44	344	12	275	pectinesterase
215367	PLN02682	5.23e-28	34	344	67	340	pectinesterase family protein
215357	PLN02665	1.11e-25	37	363	69	350	pectinesterase family protein
178051	PLN02432	1.07e-22	49	344	23	265	putative pectinesterase
178113	PLN02497	3.03e-21	44	382	37	327	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE63594.1|CE8	5.53e-284	1	388	1	388
UDD62592.1|CE8	5.53e-284	1	388	1	388
QRD94539.1|CE8	4.54e-283	1	388	1	388
QMW33764.1|CE8	4.54e-283	1	388	1	388
EAA60938.1|CE8	3.41e-207	7	382	9	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.57e-19	32	354	5	282	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	2.15e-19	32	354	5	282	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
2NSP_A	7.35e-11	39	360	7	330	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	2.52e-06	39	318	34	297	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT4|PMEA_NEOFI	3.74e-20	6	344	8	296	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	1.18e-18	32	354	33	310	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	2.10e-18	32	298	30	256	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	2.10e-18	32	298	30	256	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|Q94CB1|PME25_ARATH	1.64e-17	36	344	295	575	Probable pectinesterase/pectinesterase inhibitor 25 OS=Arabidopsis thaliana OX=3702 GN=PME25 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000328	0.999649	CS pos: 24-25. Pr: 0.8604

TMHMM  Annotations     

There is no transmembrane helices in KAB8201699.1.