CAZyme Information: KAB8201667.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8201667.1
• CAZy Family: AA7
• CAZyme Description: putative beta-glucosidase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827		90867.49	6.4038

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML735016:87728-90310(-)

Full Sequence      

MTFDIDYVLSHISQEDKIALLAGIDFWHTHPIPELNVPSIRSTDGPNGIRGTKFFAGVPA
ACLPCGTALASTWDQDLLREVGVLIGKECLAKGAHCWLGPTINMPRSPLGGRGFESFAED
PHLAGAMAASMITGCESTGVISAVKHFVGNDQEHERRAVDVLVTQRALREIYLRPFQIVA
RDAGPGALMTSYNKINGKHVVESKEMLDMVRQEWKWNPLIMSDWLGTYTTIDSMNAGLDL
EMPGPSRYRGRYVESALQARLIKESTIDSRARKVLEFVQQASRAPVSAVETGRDYPEDRA
LNRKLCANSIVLLKNQNDILPLPKTIKKIALVGSHVRTPAISGGGSASLEPYYTVSLYDA
VSEALPHTEILYEVGAYAHKMLPVIDRLLTNAVMHFYNEPVGTERILRATQPMSKTAFQL
MDFNAPELNRGLFYATLTGDFTPDVSGVWDFGLTVFGTGLLYVDDELVVDNTTHQTRGTA
FFGKGTVQELGSKTLNAGQTYKIRIEYGSANTSPMKAIGVVHFGGGAAHLGACLHVDSAE
MVRSAVRIAAEADYTILCTGLNHEWESEGFDRSHMDLPPGIDELITSVLDVAANKTVIVN
QSGTPVTMPWADRARGIVQAWYGGNETGHGITDVIFGDVNPSGKLPLSWPVDVKHNPAYL
NYASVGGRVLYGEDVYVGYRYYEKVGREVLFPFGHGLSYTTFTVSPDVVFSQEIFRPEEP
STAAVKIKNTGKVVGAQVLQLYISAPYSPTPRPTKELHGFTKVLLQPGEERVVHIRMDKY
ATSFWDEIEGTWKSEKGIYEALIGTSSQNILAKGIFRVDRTRSWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	243	1.4e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.12e-81	64	810	121	757	beta-glucosidase BglX.
224389	BglX	2.36e-60	25	336	48	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.59e-58	310	699	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.41e-35	35	276	64	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.17e-30	8	778	56	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD60961.1|GH3	0.0	1	827	1	827
QMW31983.1|GH3	0.0	1	827	1	834
QMW44017.1|GH3	0.0	1	827	1	834
BAE61738.1|GH3	0.0	23	827	37	841
QRD91056.1|GH3	0.0	23	827	37	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.47e-249	3	827	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.34e-244	3	827	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.04e-143	1	821	1	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.60e-111	9	819	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.82e-96	32	810	87	820	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WL79|BGLH_ASPFU	0.0	3	827	5	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1
sp|B0XM94|BGLH_ASPFC	0.0	3	827	5	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|Q2U9M7|BGLH_ASPOR	0.0	1	827	1	827	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|B8NPL7|BGLH_ASPFN	0.0	1	827	1	827	Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglH PE=3 SV=1
sp|Q5B6C7|BGLH_EMENI	0.0	2	827	4	831	Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglH PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999776	0.000252

TMHMM  Annotations     

There is no transmembrane helices in KAB8201667.1.