CAZyme Information: KAB8200621.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8200621.1
• CAZy Family: AA3
• CAZyme Description: SGNH hydrolase-type esterase domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	ML735039|CGC1	36519.74	4.4640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML735039:101396-102397(+)

Full Sequence      

MVLPLRRLSAPRALSSLCSCLAIICLFVMLAMTAMRDTVEEETGNGITAHGLLEPTLKVM
IVGDSMSQGREGDWTWRFRIWEWFKEQGLTVDFVGPYNGTAQSDLPSLPATPSGKEESHW
KSEIRTSGGYAAGVSEDFDKDHFAIWGRAVAIDKELIYDVLSAYPADLILLMLGFNDMAW
FHTDAAGTVDSMQTFILNARATNPRLKFAIANVPQRTFISGREDLPVSTNIYNALLREAI
PGWSTLDSPVQLVELHENYDCAPIACPVGYDGLHPNAQGEYQIARAFTLTLVKDFNIGVS
PLSIPTMPGGPLPVSSNLQDVGSLPQEVPDMIL

Enzyme Prediction     

No EC number prediction in KAB8200621.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	57	288	5.6e-50	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.22e-46	139	291	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.13e-08	147	283	43	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	2.88e-05	145	287	46	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	3.45e-05	157	287	57	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238865	sialate_O-acetylesterase_like1	1.50e-04	136	286	32	182	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE63679.1|CE0	7.72e-224	1	329	1	329
CAK39824.1|CE0	1.96e-121	36	317	130	394
BAE60780.1|CE0	7.62e-94	109	319	19	230
UKZ09962.1|CE0	1.17e-86	40	328	502	785
SCG40251.1|CE0	1.02e-79	57	318	336	598

PDB Hits     

KAB8200621.1 has no PDB hit.

Swiss-Prot Hits     

KAB8200621.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999992	0.000027

TMHMM  Annotations     

Start	End
13	35