CAZyme Information: KAB8200195.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8200195.1
• CAZy Family: AA3
• CAZyme Description: beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835		91690.18	6.6376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML735050:54380-56996(+)

Full Sequence      

MPSQAKLEMILGSLSLEQKITLLSGDTFSATASYPEKNVPSIKIADGPNGVRAPATSPDV
RSACFPAACSLAATFDVDLARRFGRALAAEARQKNVNCILGPTVCIHRHPLGGRNFESFS
EDPFLAGKMASQVIQGLQEKGVAATIKHFAANEQETSRASVDESISERALREIYLRPFEI
AIKEANPWAVMTAYNLVNGTHCDSHTFLLRDILRGNWGWDGLVMSDWGGTNSVADALRAG
LDLEMPGPPKVRKPSVIKEFMQRGELSEDIINDRARAVLRLALKLENLEKSSSSPIDRQR
TEHNKLIRQSGAYGMVLLKNEEGILPLSKEKVKGRKIALIGYAKDVLAHGGGSASVNAYY
KVTPEEGLRTALGDDVEFIYAKGAHRERLLIPLYSNELTGKVVGANGASGFTLSFFDPGK
ENAVITRHGFVSSAYSPLGSSESYQKVIELLGYFTPTESGKHYISCSGFGPTQVYLDEEL
IFEQEKSIADPMGCLFNAAPEPEVRYQFTAGKTYRIRIRSEPPLNLGIEILEGRSGARLG
FSPVAVHDADLQGEAVRVAKEADCAVIFTGHDSQWETEGQDQASFCLPHHQNELVTAVAA
VNKNVIVINSTGVAVAMPWLDKVKGLIQAWFPGQEYGNAVADVITGVVNPEGHLPVSFPR
YIEDAPAHGNFPGEYINGKLKVNYAEGVFVGYRHYDRMPREKLNFPFGHGLSYTTFVFRN
LKIQTVNRDTFNAVVDVANNGPVSGRVLIQLYVGKMQVTGEHPVKTLVAFKKVRLETGQT
KTVDVSIEMRDFAYFEERKQKWMLDEGEYELSVGLSSAEIAKSVRFFAVNTSWDP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	246	6.3e-70	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.27e-77	65	826	120	762	beta-glucosidase BglX.
224389	BglX	4.67e-74	38	378	59	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.28e-52	315	692	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.78e-47	65	281	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.42e-38	1	814	47	769	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78442.1|GH3	0.0	6	835	5	837
QGI87315.1|GH3	0.0	7	835	6	837
QGJ00832.1|GH3	0.0	7	835	6	837
CZS81735.1|GH3	0.0	6	835	5	837
CCT74517.1|GH3	0.0	7	835	6	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.08e-176	3	829	2	836	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.12e-173	3	829	2	836	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.22e-131	7	825	5	667	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.79e-111	14	821	12	656	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.39e-106	6	820	3	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	3.28e-313	5	825	9	835	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.95e-181	8	823	7	826	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.21e-179	8	823	7	826	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1DFA8|BGLI_NEOFI	3.19e-176	4	823	3	825	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.78e-175	4	823	3	825	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999872	0.000146

TMHMM  Annotations     

There is no transmembrane helices in KAB8200195.1.