CAZyme Information: KAB8199906.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8199906.1
• CAZy Family: AA3
• CAZyme Description: Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	ML735058|CGC1	46747.79	10.0917

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML735058:25680-27045(-)

Full Sequence      

MELKHFIHELCLNPRHTKWIAPLLVVGDAFLCALIIWKIPYTEIDWTTYMQQIALYISGE
RDYTLIKGSTGPLVYPAAHVYSYIALYHLTDEGRDILFGQILFAVFYLVTLAVVMICYRQ
SGAPPYLFPLLVLSKRLHSVFVLRLFNDGLAACAMWIAILLFQNKKWTAGVTAWTVGVGI
KMTLLLLAPAIAVVTVLTLSLVPSIRLGILALLIQVLLAIPFLQGNPTGYVARAFELTRQ
FMFKWTVNWRFVGEELFLSKQFSLALLALHIFLLGLFVTTGWLRPSGSSLPAFLRNLLQG
RQRIVVLSKSFIMTVMLTSLAIGLLCARSLHYQFFAYLSWATPFLLWRARLHPLLIYAIW
ALQEWAWNVYPSTNASSLVVVFSLAVQVFGVLFNSRNALSDAPPRRKGKEHVH

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	21	377	1.4e-147	0.9972527472527473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	22	377	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62911.1|GT58	3.90e-283	1	412	1	412
UDD58266.1|GT58	3.90e-283	1	412	1	412
QMW45188.1|GT58	7.16e-281	1	412	141	552
QMW33155.1|GT58	7.16e-281	1	412	141	552
QRD84733.1|GT58	9.94e-247	42	412	118	488

PDB Hits     

KAB8199906.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U6A4|ALG3_ASPOR	6.92e-284	1	412	1	412	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	2.63e-218	1	395	9	403	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	4.35e-211	1	412	63	471	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	7.95e-211	1	395	1	395	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	1.27e-204	1	411	1	407	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000001

TMHMM  Annotations     

Start	End
19	41
96	118
140	162
172	194
201	223
261	283
304	326
377	399