CAZyme Information: KAB8198925.1

Basic Information

• Species: Aspergillus parasiticus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus parasiticus
• CAZyme ID: KAB8198925.1
• CAZy Family: AA1
• CAZyme Description: glycoside hydrolase superfamily

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	ML735115|CGC1	33430.23	4.4874

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AparasiticusCBS117618	14005	N/A	253	13752

• Gene Location: location=ML735115:16576-17610(+)

Full Sequence      

MRTAGLLSLLLAAIPAVTAERGTLGLALGNKNPDGTCKSTSDYEADFDALKSLTTLVRTY
SANDCNTAVNIVPAAKNKQFKVVLGVWADYDESFNNDFNVLKQIVPGNEDVIPSITVGSE
TLYRKGLTAQQLLDKIRTVQNAFPKVNVGTVDSWNIFDDGTADPIIQGGVTYFLANGFAY
WQGTDIDHATETYWNDTRLAKEHIEKIAGNNKDKIIFGNGETGWPTDGGSDYGNAKASTQ
NAERYWKDAVCAMLTWGVDVFYFEAFDEAWKPKSIGDNGEEKDETRWGLFTADRKAKFDL
SCPN

Enzyme Prediction     

No EC number prediction in KAB8198925.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	25	302	3.5e-40	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.11e-66	22	294	44	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.48e-40	24	302	1	309	Glycosyl hydrolases family 17.
409322	T3SC_YbjN-like_2	0.004	98	143	89	133	Uncharacterized protein is structurally similar to type III secretion system chaperones and YbjN family proteins. This family includes an uncharacterized protein from Methanothermobacter Thermautotrophicus that is structurally similar to type III secretion system (T3SS) chaperones (T3SC) that bind effector proteins, and is homologous to YbjN, a putative sensory transduction regulator protein found in Proteobacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46467.1|GH17	2.60e-226	1	304	1	304
QMW34414.1|GH17	2.60e-226	1	304	1	304
QRD93805.1|GH17	2.60e-226	1	304	1	304
BAE64088.1|GH17	2.60e-226	1	304	1	304
CAY05236.1|GH17	2.60e-226	1	304	1	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.03e-32	34	297	46	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	7.67e-32	34	297	46	289	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	1.03e-122	1	302	1	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P15703|BGL2_YEAST	1.19e-71	22	302	25	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	1.66e-67	11	302	9	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	1.32e-66	11	302	9	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|O13990|BGL2_SCHPO	1.53e-62	15	302	35	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999745	CS pos: 19-20. Pr: 0.9847

TMHMM  Annotations     

There is no transmembrane helices in KAB8198925.1.