CAZyme Information: KAA8917778.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8917778.1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	SWFS01000011|CGC2	57256.27	8.3557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000011:106790-108289(+)

Full Sequence      

MTSVARAAPPQQPSPEPEAEDAHAQHQKHQPRDNKLYLPLGSSASSLSYLHKQPRGYVKS
PPIEFLAHSDPEGPPPPIVRKKSGERVKSSLKLPGLVRARSMPNTKNVHFDSRDYIRQFS
RTDQPTAVSVDSSPTIEKRRIEFTCGEGTDEDSDGSSSSSCSSSSDEDENMFSRRTEWSI
RLTNFTKPTVSLESPNVVLESVSLSSDKERLVGHVLVRNLSYHKCVTVRYTLDYWKTVSE
VVAMYNDDIRKRYRNLNYDKFTFTINLHDLPQHALRSKSMFFCIRYNTNGLEFWDNNGRF
NYQIDFTRIPKQKQRTKTTNKHSRGRHHHRSLSEPPLDDHDFFLDAAISPDLHPVEASKN
TSPTKSKVKKLTSRYNFGASFRNHHHHHHTHDETTDEEETFSFPKTSSHHPSLTDQISRP
AWDSSSYQDLLNNYCFFTEKKDLKHNTATTTSKQKNDENDDESESDSQVSPTNTTNQHPQ
IPKPFLPSTKNDILRQIYV

Enzyme Prediction     

No EC number prediction in KAA8917778.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	196	304	4.2e-33	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	2.82e-45	192	305	2	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	3.85e-09	219	304	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG82944.1|CBM21	6.70e-56	76	381	530	838
QNP96663.1|CBM21	6.70e-56	76	381	530	838
AOW01485.1|CBM21	6.70e-56	76	381	530	838
ANB12037.1|CBM21	2.34e-52	78	451	259	824
BAK05214.1|CBM21	1.50e-46	76	437	221	614

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2M83_A	4.69e-09	192	304	27	133	Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1 [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5U2R5|PPR3C_RAT	4.85e-12	197	304	157	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q7TMB3|PPR3C_MOUSE	6.51e-12	197	304	157	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q9UQK1|PPR3C_HUMAN	3.77e-11	197	304	157	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q6DDQ5|PPR3C_XENLA	1.86e-10	182	304	116	237	Protein phosphatase 1 regulatory subunit 3C OS=Xenopus laevis OX=8355 GN=ppp1r3c PE=2 SV=1
sp|Q0VCR4|PPR3C_BOVIN	2.19e-10	196	304	156	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8917778.1.