CAZyme Information: KAA8917583.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8917583.1
• CAZy Family: GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		47677.78	6.5692

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000026:86779-88014(-)

Full Sequence      

MDNSQGLKNPNFEGYNILKRSWQLFWDDKKNRFHNSNNSDGSYGKEGVYTVWPVAVMVQS
IVDAARIYPDEVIPLMERALKSFDAYYSPQYHAYCASHNFNGNSDIYYDDNAQVASCFLT
AYEVTQKREYLDKAVENVNFLMTGMRHGKFGGVRWHMEKQGSNACTTAEVGVAAMRLARF
VTPNDAYVQAGKYCIDWIFETLQDPGDKLICDGMEPDGKGGMKQNKTKWTYNQGTTLTLC
CMVYFATGDEKYKQKAEELAFAVTDHNTAIFDRDTPRMEARYYRDYTYFYHLLAEGLADF
MLYFDGKSPQKVTDQVKGELFHHLEYMWKYIRDPEDGLYWQSLELFRINKRTYEQFKELT
GEGKKYEPRDCEREHTKAPIEDRKMVKSLIACGGAARIFFQSARVHPKVDL

Enzyme Prediction     

No EC number prediction in KAA8917583.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	34	341	2.4e-53	0.8240223463687151

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.20e-36	33	302	16	293	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	7.86e-10	18	299	15	283	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB13839.1|GH76	1.15e-182	11	410	6	404
CAG84200.1|GH76	1.25e-118	7	410	6	411
QNP95380.1|GH76	1.25e-118	7	410	6	411
AOW00907.1|GH76	1.25e-118	7	410	6	411
CDR47531.1|GH76	4.76e-117	7	410	7	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	9.66e-17	75	296	82	299	Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	3.42e-16	101	322	224	449	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4C1S_A	1.29e-11	107	260	106	265	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	7.32e-51	13	405	9	413	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8917583.1.