CAZyme Information: KAA8917278.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8917278.1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
976	SWFS01000050|CGC2	112014.45	5.9453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000050:36960-40578(-)

Full Sequence      

MTIDNPVVECSTFHCHKGSRQALATPHPTWYAGSAKIPWESLGLAQIGEKITWLGGSEGA
IDPQSVKGLEKLVARQLPQVKNKVEFQLDESLEGENGFDSYEVREDPGSGKIHVVGSTRS
ALATGLYQYIQDKGHAAVSWTDSTLKTLHQLPSLCDENGECESVKGSAVVPYRYLFNTVV
WGYTTAYYTWEDWEHLLDWAALHGVNVPLAWNGYEQLLIEVLRDFGFTNEHLEGFLSGHA
FLPWNRFGNVQGSWNATFDFKLARRQLDLQKKIVNRMVELGMTPILPAFTGFVPREVRDL
YPEANVVNSTRWNDFPTVNSNTTILEPLDPLFQKIQKAFLAKQKKYLGEVTHMFTLDMFN
ENTPISGDLKYLKDVAAGTLSSLKSVNPNAVWVMQGWLFYYESEFWTDDRVEAYLSGSPK
GDLLVLDLFSDHCPQWERTKSYYGHHWVYCELHDFGGNMGLEGSMQFLTQNFTAARLRNP
SLMGVGLTPEGNEGNQIVYDIMLAQAWSNQPLDLHDYTTKYIKSRYGPGHVPEIVLDFWK
SLVDLVYTNDQTTGVYAVSKSMFEERPALNGIADKPGIQPTRLAYEPKKLEELWEKFITW
VIENPEWLEQPHFNHDVVDITRQVIANRFLPAYLEFVSLYAQGASRDALLSQGDEMLSIL
RQLDTLLYTNGDFCLGKWISAAKNLGSKGFDQISEFGARNQLTIWGPHAQINDYASKQWA
GLVGDYYVRRWAQFINFIAERRSKKSGGMLFQNYINLINDFSSMLGFGSYSIDRDADEEF
RSIALTFEQSWQWETWGSHPDQSWTNQSEAEIPKDYYWTNRAPWKPENTEKMTASCANTK
SLMKKVYLHSRDKWKEWLNSCHQDAHEGLHKGHIGYQLYFKDYPNPLKRISWKSPLHLPS
RIIQIRTQNGYFGCYFQRLRIPNKEYNCSFDELEDISHILVRCDHYENIRQVLRQVSPKI
NLNVLLDSEKGLEAVV

Enzyme Prediction     

No EC number prediction in KAA8917278.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	109	747	3.2e-189	0.9336349924585219

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	1.80e-166	173	509	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	9.22e-57	517	740	1	214	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	2.00e-13	67	152	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX62920.1|GH89	2.63e-208	52	740	5	699
QGA19502.1|GH89	3.41e-208	65	742	33	709
QYS99001.1|GH89	3.79e-201	54	739	14	690
UKZ51971.1|GH89	3.06e-197	53	739	9	691
UKZ88341.1|GH89	4.67e-194	53	739	9	692

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	2.66e-113	62	740	2	661	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	8.29e-81	64	736	169	822	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	9.42e-81	64	736	177	830	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	7.90e-80	64	736	192	845	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	2.32e-114	54	740	15	684	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	6.69e-107	60	745	43	759	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8917278.1.