CAZyme Information: KAA8917143.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8917143.1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512		59252.08	5.9070

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000063:26627-28165(+)

Full Sequence      

MGLGSWIKNISVTTDPVAAQPASTPNQPPTKRQIYQNRFNHGPNLGAMFVLEKWICDGPF
GEKAKGTSELDAVKSCRKQHGESKAKEIFEDHWRNWMQDDDWKWLREHGVTAVRAPVGYW
MVNNGAFADNTPFEKYAKIYSNAWNIFKECVLTKADQYGIAVLVDLHGLPGGANEQDHSG
TCLGKADLWESTKNQNQAFEVLQFLAEDIKPFDNVCGLQILNEAPFDTGPEGASKPQQEF
YLKAMQKIRQVNMEIPLVISDAWDLPQWVEFVKRQESRWPPNDPQSMGVIIDTHVYKCFS
DDDKNKPPEHLVNDVDNAVMDAPEVDILVGEFSCVLDGQSWDKHHNQTSREDVVRWYGQK
EMAHFFHRTRAGCYFWTYKFLHGRGGEWDFREMTDKGAIPNVKVQHNRDHDFFTQEFQRR
FHDKVGQHAGYWQSVDPNRDWEVWRFQEGFTQGWNDSAAFDAFDNSEIGRLAAWIKSREN
QHIKERGYSDLTWTYGHGFRQAVFEFIDAKRQ

Enzyme Prediction     

No EC number prediction in KAA8917143.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	89	386	2.5e-111	0.9931740614334471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.87e-25	25	390	3	327	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB11837.1|GH5_49	1.47e-197	1	507	1	511
AWU74856.1|GH5_49	4.45e-153	1	512	1	501
AWT08570.1|GH5_49	6.30e-153	1	512	1	501
AEZ66639.1|GH5_49	1.79e-151	7	506	6	494
AEZ66642.1|GH5_49	3.58e-151	7	506	6	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	7.51e-24	35	400	4	379	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.37e-23	35	400	4	379	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.47e-23	35	400	10	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	1.97e-23	35	400	9	384	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	3.63e-23	35	400	10	385	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38081|YBQ6_YEAST	7.59e-95	25	506	27	498	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|O74799|EXG3_SCHPO	2.69e-80	31	478	5	429	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	3.23e-25	42	400	44	387	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q12700|EXG_SCHOC	3.63e-24	35	300	37	285	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q5B6Q3|EXGB_EMENI	1.37e-23	30	400	41	397	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8917143.1.