CAZyme Information: KAA8917072.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8917072.1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
875		95929.82	6.4281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000066:31342-34143(-)

Full Sequence      

MTQSDSYAVEEVLEGLTTEEKIELLSGNADAWPRELRLGGSPKNNFRKRLVQYLNRVTDK
IVCIGRDFWHTNAVSGLPSVRMSDGPNGVRGTKFFNGVPAACFPCGTALGSLMDKELLYE
AGKLMAMEARAKGAHIILGPTVNMQRSPLGGRGFESFSEDPLLSGTAAAAIINGIQDNGI
QATIKHYVGNDQEDERSAVNAIIPERALREIYLKPFQIAMRDARPAMVMTAYNKVNAVHA
AECKRLLTDILRKEWNWQGAVTSDWFGTYSTVDAVKAGLDIEMPGPAVWRGRLLSTSLAT
RTVSMNDIDDRARAIVRLVRKCMAESGVPENAPEGTNDTPETARLLRQLAAESLVLLKNE
DNVLPLAKNKSTAVIGSNGKIASFCGGGSASMRPYYKVTPYDGIARKLESEPQYAIGVDS
SLTLPLAGDQLTTAEDKPGFIFKTYNSPRSDPNRKHVDTLHLVDSSMFLADYDPGLPKDK
PYYIDITGYFTPEEDGVYEFGVIVTGTALLYVNDELVVDNATVQRPGDAFLGSGTIEEKG
TIHLKKGVKYKVFVEFGGAATSKLKRTGTPMFGGALRLGLRKQFDAADEISKAIEIAKNV
DQVILTLGLNSDFESEGFDRKHMDLPPHVDELVEAVSAVNKNVVVVMQSGTPVTLPWIDR
VKGYIHAWYGGNETGNGIADVLFGDVNPSGKLPLTFPKRVQDNPGYLNYSSENGVVVYGE
NVYVGYRYYQAVGRDPLFHFGQGLSYTSFTYKTRAIDIRGGDGLDGELHVSVDVTNTGKL
AGKDTVQIYISQQHPSIGRPPHELKGYSKVYLTPGETRTAHIKVPLKEACSYWDDSRVKW
IMEKGNYEVHVAASSVEIHHTEVITIAKTTWWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	75	284	5.3e-66	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.45e-77	103	862	120	761	beta-glucosidase BglX.
224389	BglX	3.34e-69	16	381	1	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.10e-53	354	726	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	9.90e-42	103	318	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.47e-39	16	824	60	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB15424.1|GH3	0.0	52	875	23	845
UPK92097.1|GH3	4.65e-311	7	875	15	846
UQC84651.1|GH3	1.10e-308	57	875	15	833
AJA36818.1|GH3	1.07e-307	65	875	24	838
BAE61980.1|GH3	2.06e-305	65	875	24	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.94e-261	48	875	7	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.70e-256	48	875	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.18e-137	48	869	6	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.17e-120	65	866	23	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.59e-98	76	858	50	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	1.89e-308	65	875	24	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.89e-308	65	875	24	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	8.76e-307	65	875	24	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	3.66e-306	65	875	24	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.42e-305	65	875	24	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8917072.1.