CAZyme Information: KAA8917052.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8917052.1
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843		92271.64	4.8646

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000068:25989-28520(-)

Full Sequence      

MMLFNLLLLLFIGLVNADFSFSPRVYPSPQGGRSTADADWEEAYEKARAFVSDLSLIEKV
NLTSGIGGFGVCVGNTRDLPNRNMWGLCLQDGPLGIRTTDYNTAFPAGISAAATFNRDLI
YDRGMAIGREFRDKGVDIALGPAIGPIGLKALGGRIWEAMGADPYLQGIAGAETVKGMQD
AGVIANAKHFLVNEQETDRLKVSSNVGDRALHEIYAWPFADLVHVGVGSVMCSYNKLNES
FGCENSYMMNQILKDELGFQGFVVSDWGATHSGVNAITSGLDMDMPGTAGMLQSQSYFGA
NTTISVLNGTLPMERLDDMATRIMAAFYKVNLDQIREQRGPPNFSQQTQNDTDYLYPPVE
MGPMVTVNQHVDVRTDEAYRVAYETAAEAVVLLKNRNNTLPLDGKKVKKLAMFGKAGFPN
DFGPGCGSVAGCQPEQQRGASAMGFGSGAATLPYFITPFEALNERARREKTMVDYSLGLN
TSDPSFSVPAQISHANVIFAMSYAGEGEDRENYTLWYDVDKTIEAACKLNKNNIVVVTSP
GPVDMEKWIDNPNVTAVLFTTPGGQDAGQALADVIYGDQNPSGRLPFTIAKDTKDYVPLS
TSKNSTSPQDDEPEKVDLLLDYRYFDQKNITPRYEFGFGLSYSNFSLSNLHIVTLENPSE
HLPDPPQWKEPYHSNDTSVSATDALFPSNIKRIPGFLYPYINSTSQADKKGSYPFPPEYS
TKQKSKPSPAGGASGGNPALWKVAYNVNATVTNNGDRAGKYVAQLYIGYPASDKFPSPPK
QLRGFDKVELEPNQSTEVSFNILTRDLSVWDSVTSSWIVQRGDYHIYVGSSSRNLELHST
IRI

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	286	5.1e-56	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.95e-50	103	833	118	755	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.24e-49	390	642	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.86e-47	65	442	32	387	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.38e-42	46	802	52	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.04e-31	103	323	86	313	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB13095.1|GH3	1.38e-287	18	843	39	901
ANB15451.1|GH3	3.06e-285	15	843	32	896
AAA34315.1|GH3|3.2.1.21	2.78e-247	22	836	40	873
AOW31603.1|GH3	8.21e-247	10	843	68	922
CCE42455.1|GH3	1.84e-246	26	843	67	904

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	1.36e-221	18	841	2	837	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5FJI_A	1.25e-208	18	841	2	840	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	1.86e-207	18	841	3	838	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5JU6_A	2.97e-207	15	842	17	852	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5NBS_A	2.35e-200	18	841	16	856	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P22507|BGL2_SACFI	4.94e-248	22	836	40	873	Beta-glucosidase 2 OS=Saccharomycopsis fibuligera OX=4944 GN=BGL2 PE=3 SV=1
sp|P22506|BGL1_SACFI	2.15e-237	22	836	38	869	Beta-glucosidase 1 OS=Saccharomycopsis fibuligera OX=4944 GN=BGL1 PE=3 SV=1
sp|P48825|BGL1_ASPAC	6.45e-221	15	841	17	856	Beta-glucosidase 1 OS=Aspergillus aculeatus OX=5053 PE=1 SV=1
sp|A1CR85|BGLA_ASPCL	5.82e-215	22	841	31	863	Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglA PE=3 SV=1
sp|Q5B5S8|BGLA_EMENI	1.63e-213	18	841	25	859	Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999742	CS pos: 17-18. Pr: 0.9826

TMHMM  Annotations     

There is no transmembrane helices in KAA8917052.1.