CAZyme Information: KAA8916966.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8916966.1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	SWFS01000075|CGC1	65147.63	7.6795

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000075:1338-3113(+)

Full Sequence      

MLETLRASLPPLEVLTCIVIFAGIISAGCVYVTFCYVLYVLGTRLRTPPKGWKRYLDDAV
AAGVVKLPDFGAAKAASIRRQLILASSQPGRYSNDRAMTLGRDIGRGAFDIHYKDGTQVN
RKVVFGFFHPYADAGGGGERVLWAAVRQTLQNNENNVCAIYVGRDAAPNATTAAQGAAST
GASPDAASGDAILDRVDARFGIEVDRARVVFIFIAHRTLVHPLTWPRLTLVGQAFGSAVL
AYEAISSLVPDVFVDTAGYPFCYPLISWLLGIPVCAYVHYPVVQPDMLAGVGPLSVRGLY
WRAFMRAYALMARYATLPVTNSTWTNEHMRRIWGPGAAKRPDLITTVYPPCAVQDFAPPT
PGQVRKPHVVCIAQFRPEKRHDLLLREFARYLENRAADATDKPHLVLIGSVRDEADSQRV
YSLRVLARELGIIEDHVTFLLDAPWSTVQEILSHASVGVNAMWNEHFGMGVVEYMAAGLI
PVAHNSAGPKLDIITPPEDDSSGERPGFLFTDPSDPDYAPDAKHNVSLSQCLDQALSLSQ
EEQDRLRLQAYNAAQRFSDPEFDKRWDVRVNTLLKLEKLKRNKRLLAGAFD

Enzyme Prediction     

EC	2.4.1.131:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	365	517	1.1e-21	0.81875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340835	GT4_ALG11-like	0.0	123	565	1	419	alpha-1,2-mannosyltransferase ALG11 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides.
215511	PLN02949	5.71e-113	120	574	31	458	transferase, transferring glycosyl groups
406369	ALG11_N	3.31e-93	123	333	1	208	ALG11 mannosyltransferase N-terminus.
340831	GT4_PimA-like	1.43e-23	252	576	86	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	3.10e-21	198	584	31	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB11712.1|GT4	2.91e-188	41	591	1	528
QNP98501.1|GT4	1.54e-135	12	591	22	635
AOW03785.1|GT4	1.54e-135	12	591	22	635
CAG80767.1|GT4	1.54e-135	12	591	22	635
CAR25027.1|GT4	7.41e-116	46	566	33	559

PDB Hits     

KAA8916966.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6C9T3|ALG11_YARLI	2.73e-136	12	591	22	635	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG11 PE=3 SV=1
sp|Q75B12|ALG11_ASHGO	3.95e-111	45	582	41	578	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ALG11 PE=3 SV=1
sp|Q8X092|ALG11_NEUCR	3.40e-101	41	566	35	536	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-11 PE=3 SV=1
sp|Q6FWD1|ALG11_CANGA	1.90e-99	114	567	37	489	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG11 PE=3 SV=1
sp|Q6CLD6|ALG11_KLULA	5.94e-99	69	567	61	555	GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ALG11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000038

TMHMM  Annotations     

Start	End
20	42
261	283