CAZyme Information: KAA8916904.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8916904.1
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663		72724.04	8.3217

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000078:252533-255671(+)

Full Sequence      

MVEGNVLVISNRLPVTIKRTEDGKYDYTMSSGGLVAALSGLKKSTNFKWFGWPVPEDEKE
RVRRDLHEKFSCIPVFLSDDLADLHYNGFSNSILWPLFHYHPGEMNFDEDAWKAYTEANR
AFAKEIAPIVKKDDIVWVHDYHLMLLPAMLREEISPDLKIKVGFFLHTPFPSSEIYRVLP
VRREVLLGVLRCDLIGFHTYDYARHFLSSVSRILRVNTTPNGVEFDGRKVVVGAFPIGID
TDKFIEGLKAKEAKDRISALQKKFEGVKIIVGVDRLDYIKGVPQKLHAFEVFLSEHPEWI
GKVVLVQVAVPSRQDVEEYQNLRAMVNELVGRINGRFGTVEFTPIHFLHKSINFNELISL
YAVSDVCFITSTRDGMNLVACEYIACQQEKHGSLILSEFTGAAQSLNGSMIINPWNVDEV
ASTLYDALTLPNEKKEANHQKLFKYITKYTSAYWGENFVKELSSMEATTTATAVTATAST
TTATSTTTAVAATTTTIATAATATSSSTAAAAAITATATVAAAITASTTVVVAVITTATI
TTSTAIIPSTAITPSTAITTSTTTTTSTTITTSTAITTSTAITATAAASSARAAWNQSLK
TRCTGTTRAATKEFHSRGIGILVYRLNFSRIGKEGLHFRRVPGWRGNCGRHSCRWSGIGA
QCC

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	4	463	6.2e-199	0.9705263157894737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215555	PLN03063	0.0	6	462	13	475	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
274112	trehalose_OtsA	0.0	5	464	1	456	alpha,alpha-trehalose-phosphate synthase [UDP-forming]. This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This model excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This model does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cutoffs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see Wolf, et al., ). [Cellular processes, Adaptations to atypical conditions]
395781	Glyco_transf_20	0.0	4	462	1	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	0.0	6	462	3	460	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	0.0	1	462	12	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA09463.1|GT20	3.22e-262	5	462	3	466
QNP98978.1|GT20	3.22e-262	5	462	3	466
CAG79544.1|GT20	3.22e-262	5	462	3	466
CBF70458.1|GT20	3.22e-262	5	462	3	466
CBF98942.1|GT20	3.22e-262	5	462	3	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HUV_A	1.26e-250	1	462	1	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.26e-250	1	462	1	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVM_A	2.79e-249	3	467	11	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	7.06e-242	6	465	2	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	4.00e-230	6	462	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74932|TPS1_YARLI	5.71e-263	5	462	3	466	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=TPS1 PE=1 SV=1
sp|Q00764|TPS1_YEAST	3.36e-254	4	473	16	491	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS1 PE=1 SV=2
sp|Q92410|TPS1_CANAL	6.47e-250	1	462	1	467	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPS1 PE=1 SV=1
sp|Q4WLM9|TPS1A_ASPFU	1.44e-248	3	467	11	479	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=tpsA PE=1 SV=1
sp|Q07158|TPS1_KLULA	1.53e-248	4	462	16	480	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=TPS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8916904.1.