CAZyme Information: KAA8916602.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8916602.1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858	SWFS01000093|CGC2	98243.43	5.0209

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000093:82834-85410(-)

Full Sequence      

MYSRIDVDKGWEFTQVSDLNGNCAGDKYYPATQFPTVVQLDLLKHGLVPDPHYDQNEPKN
LWAGEADWTYRTQKVPDVEIGKNERAVLVFEGLDTAVDVQLNGKHILSGKDMFLEYRVDV
TDILKAANGESELVLKFQSAVMTARKERERIGENSGGEHLNFGGTERLFLRKAQYHWGWD
WGPVINTCGPWKPIYLEKYTARVSDFQVVAEVPESLNKATVKVHGSLEGMDTATIQVKDP
NGQVLETRQVKTDKDSKYSTEIEVKSPQLWYPHQYGKQPLYTASICLGDKEAHCVEKAFG
LRRLRLLQNPLRNADGFSFTFEINNIEVFCGGTDWIPGDNYLPTMTPDRYEQWVKLAKAG
NQTMIRNWGGGVFEEEAFYDACDREGVIVWQDFLFACGNYPASKDFVELVRQEVVQQTKR
VNHHPSLVLLCGNNEDYLLANRWGWDWDIDDEEGPWDDTNFPARWIYERTMPEVCEEVCP
HIPYFRSSPYGGRYANDPTAGDTHIWDVWHGQMAPYQDYVKFISKFVSEFGFESPANIRL
YNKYISDHRERHSQSRTFDVHDKGPGYQRRYGMYLAENYRFRMDPLEDYIYCTQLLQAEA
MFYAITRFRREFKGPEHNSCSGAVVWQLNDVWPGQSWAVVDYEMNPKPSFYSIKHALEST
AIGIDRKITKGTGYVLRTYLPEKAAGSVWAVTTNISEIQATVHLKAFNVETGSPVELNQP
PKSVTLLPNRSVELIPDFNIPDAENTVVAAYLQTKDSSEILARYISWPEPFKYVRFHPSP
TISITTQKDSLSITTDAPLKGVVLSVPPEEGNDATWEDNYLDLVPNDPIKFGVTGLNNRP
ISIKWLCDWEANPNIIYK

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	721	1.1e-78	0.6941489361702128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.83e-81	1	654	9	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	3.32e-11	201	302	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407658	Mannosidase_ig	1.25e-09	687	773	4	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
407625	Ig_mannosidase	0.005	781	831	7	56	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ74807.1|GH2	0.0	3	854	4	866
QYS95286.1|GH2	0.0	3	854	4	866
CEI70352.1|GH2	0.0	1	853	1	861
QPC62730.1|GH2	0.0	1	853	1	861
CCT66619.1|GH2	0.0	1	853	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.69e-130	5	825	27	802	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	1.36e-105	3	834	4	833	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.39e-105	3	834	4	833	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	9.52e-105	3	834	2	831	Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	9.72e-105	3	834	4	833	Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	2.69e-231	5	835	7	840	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|A1CGA8|MANBB_ASPCL	5.36e-199	4	846	6	843	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	5.92e-195	4	846	6	843	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
sp|Q4WAH4|MANBB_ASPFU	6.62e-194	4	846	6	843	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	1.32e-193	4	846	6	843	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAA8916602.1.