CAZyme Information: KAA8915826.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8915826.1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		42658.75	5.7483

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000138:69883-70995(-)

Full Sequence      

MPATIADISPKQVHSAISLLTDGLVSIRDVDQERVFVIDGVTIDTKAWNSWEWTHGIGLY
GQWYYYAQTGSTKALEVMKDWFENRLFKEQIMPKNVNTMAPFLTLAYLYEHFKDQRYLVF
LDTWAEWAMYEAKRTRHGGIQHVTYLEDNHNQLWDDTLMMTVLPLTKIGKLLNRPHYIEE
AKRQFLIHIRYLADIKTGLFYHGFCFDGNHHFANALWARGNSWLTIAIPEFLELLDLPDE
DGFKQYLLEVYESQVEALAKLQDPESGLWHTLLDDPSSYLESSATAGFAFGILKGIRRRY
ISKEKYLDVGLKAIKGVLNNVDSNGELLNTSFGTGMGRDLQFYKDIPITSMPYGQAMAIM
ALSEFARFFV

Enzyme Prediction     

No EC number prediction in KAA8915826.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	45	367	1.4e-110	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.69e-111	38	369	23	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.28e-102	39	369	15	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX50406.1|GH105	2.42e-165	2	370	5	381
CAY67731.1|GH105	9.77e-165	1	370	1	371
CCA36818.1|GH105	9.77e-165	1	370	1	371
SOP79356.1|GH105	9.77e-165	1	370	1	371
AOA66592.1|GH105	9.77e-165	1	370	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	4.19e-153	12	370	7	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	2.59e-151	8	367	21	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	4.19e-143	8	367	22	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	6.54e-17	151	365	125	358	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	6.26e-16	177	348	225	392	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	2.01e-45	31	364	7	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	2.34e-13	154	364	201	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KAA8915826.1.