CAZyme Information: KAA8915522.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8915522.1
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	SWFS01000160|CGC1	37566.16	8.7982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000160:23850-24812(+)

Full Sequence      

MKRELRWMLIINGAIILFLVYQASDLISLLYDDSQKDAISDEELVLSNHNSTDALIPRII
HQTYKNETIPAGWNQTHRSCVDLHKDDYQYILWTDEMARDFISRHYAWFLDTFDNYPYPI
MRADVIRYFILWHYGGIYIDLDNGCTDRLDPLLNFPAWLRKTIPTGVSNDIMGSRPGHPF
FKKVIDNLEKYNRNWFVSYITIMFSTGPLFVSVMCKQYKRQGDLSPTDAIRVLVPPKNNN
GHSTYFFYTAKGSSWHLGDAKFIMQMAKHWIFFTILGTLLVLSVLYLQYRIYQRLSRVGG
IRRFFSKNNTLGNYSNLDQV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	154	2.4e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.71e-72	17	320	47	344	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.23e-22	70	153	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANB15855.1|GT32	8.17e-136	1	308	1	313
CCG25834.1|GT32	2.58e-108	1	307	1	298
CCE44715.1|GT32	5.17e-108	1	307	1	298
CCE85744.1|GT32	8.37e-108	1	315	1	312
SGZ58833.1|GT32	1.25e-107	1	269	1	267

PDB Hits     

KAA8915522.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	5.45e-103	1	292	1	296	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	6.36e-98	1	292	1	288	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.55e-81	12	306	24	307	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.10e-80	48	277	74	303	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	2.06e-57	56	301	64	307	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.974676	0.025358

TMHMM  Annotations     

Start	End
7	29
195	214
270	292