CAZyme Information: KAA8915471.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8915471.1
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485		55501.36	8.2471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

• Gene Location: location=SWFS01000163:65045-66502(-)

Full Sequence      

MREMRDRGCEELEGKEGLLGDGKLRTDGRMDLTYYFVGFLIVIYLLVPTFLYLVTPNPPD
ESDLYKRRRVIVLVLGDLNRSPRMNYHAKSLAQLGYHVDLCGYNSADEEHEYVKPHELVQ
LHAIPEIKNRLNLPFLLFAVHKVILQHYYLYRLLKELKGADFLLVQNPPSVPVLGVVRFY
ILFVSQHTKLVIDWHNLGYSILALKLGNRHPFVWLYRWYEKILGRRAFAHLTVTVTMAKE
LRSQFGMDARRIIPLHDRPAEQFQVISSEKRGEVIKELESRYSQFRVHDDELVVVTSTSY
TPDEDLGMLLDALKTYDKQSPPLKKLRVIITGKGPMYSEVSQRIGQLELARVSIHQLWLS
NDDYPKILGIADLGVSLHTSSSGWDLPMKVVDMFGCGVPVIALKFEALHELVKDLKNGLT
VTDSDTLVGALQDLTSNPKSLAQIQKGALEESKLRWAKNWSTKVGPLFLMNNLLRPKPEH
SSDSE

Enzyme Prediction     

EC	2.4.1.142:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	68	466	2.7e-138	0.9929411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	66	468	2	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	1.28e-123	66	434	3	370	transferase, transferring glycosyl groups
223515	RfaB	7.43e-19	96	458	20	365	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340831	GT4_PimA-like	6.39e-17	88	451	24	347	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340825	GT4_WbuB-like	9.36e-16	76	458	12	385	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ00915.1|GT33	9.81e-148	40	483	10	453
CAG80366.1|GT33	9.81e-148	40	483	10	453
AOW06371.1|GT33	1.39e-147	40	483	10	453
ANB13796.1|GT33	2.10e-141	84	484	1	436
SGZ53184.1|GT33	1.78e-116	28	468	5	461

PDB Hits     

KAA8915471.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6C3K2|ALG1_YARLI	1.74e-148	40	483	10	453	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG1 PE=3 SV=1
sp|Q6BS98|ALG1_DEBHA	2.18e-113	34	468	24	467	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ALG1 PE=3 SV=2
sp|Q59Q79|ALG1_CANAL	4.22e-112	40	468	24	452	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG1 PE=3 SV=1
sp|O13933|ALG1_SCHPO	5.03e-102	67	472	24	424	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg1 PE=3 SV=2
sp|Q6FLZ2|ALG1_CANGA	3.36e-94	40	470	14	449	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ALG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000054

TMHMM  Annotations     

Start	End
32	54