CAZyme Information: KAA8913077.1

Basic Information

• Species: Trichomonascus ciferrii
• Lineage: Ascomycota; Saccharomycetes; ; Trichomonascaceae; Trichomonascus; Trichomonascus ciferrii
• CAZyme ID: KAA8913077.1
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		63441.41	4.7558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TciferriiCBS4856	6909	N/A	6	6903

Full Sequence      

MLFKHSVLLALAGIALGKPNLEFVDDETSIIGNGDGFQMTINSTSGYGYSIKDGETELVG
SAVGAYVDTGGRHTFNYTKPEIEQSTDDLIDVKYAAIEGDVHYVFQSGLKGFYSYVVTRD
FPTAGEFRSLLRLSPDIYTWGRNNEVDAPLPLIQDIENGYKVQDETFQRPNGSFITKYDF
SAFVRDLDFHGVHGNGHGAWLISPSKDYYVGDQLKQELMIHRESKTNDAVLLNMVHGTHL
CAEFSEEIPEGKIWGPWLFYFNDGDLDDVSKRVKEEGKKWPYEWLQDEKYHDRGNVKGQI
VLQDGTPASGAAVFLGEPGRTVSQGAHYQYTGYADDKGHFEFKNVRREKEYALQAWASNK
SDRLRNVSTVFEKNNITIEKNTNLGKLTWELPKDRSPVWQIGAFDRLSDGFKNSDKPRVH
GLSDESPAYLYYAIGVNEEKDWYYAQSSEGNWTVLFDVDTTDKDAIISASFAGYTAIARD
DVNSGAVPVTLSLHMNGQPIGNISDDKAADSALYRSANRAGGYYYQELTVPHDTLVEGSN
RLDLVLINGARWKGIIWDAIKLELTN

Enzyme Prediction     

No EC number prediction in KAA8913077.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	30	548	8.9e-171	0.9903660886319846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	5.24e-48	58	265	51	260	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199905	RGL4_C	1.18e-29	399	563	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	8.85e-27	397	562	1	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199904	RGL4_M	2.96e-13	292	387	1	92	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	0.002	303	358	1	54	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAY71272.1|PL4_5	CAY71272.1|PL4_5	8.84e-137	53	561	84	608
AOA65347.1|PL4_5	AOA65347.1|PL4_5	8.84e-137	53	561	84	608
AOA69870.1|PL4_5	AOA69870.1|PL4_5	8.84e-137	53	561	84	608
CCA41121.1|PL4_5	CCA41121.1|PL4_5	8.84e-137	53	561	84	608
SOP83916.1|PL4_5	SOP83916.1|PL4_5	8.84e-137	53	561	84	608

PDB Hits     

KAA8913077.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RJP2|RHIE_DICD3	sp|Q8RJP2|RHIE_DICD3	7.54e-72	69	565	88	576	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1
sp|Q5AZ85|RGLB_EMENI	sp|Q5AZ85|RGLB_EMENI	1.94e-21	12	564	11	659	Rhamnogalacturonate lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rglB PE=2 SV=2
sp|A5ABH4|RGLB_ASPNC	sp|A5ABH4|RGLB_ASPNC	4.77e-20	126	546	154	635	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
sp|B8N5T6|RGLB_ASPFN	sp|B8N5T6|RGLB_ASPFN	1.04e-19	1	564	1	662	Probable rhamnogalacturonate lyase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rglB PE=3 SV=1
sp|Q0C7K7|RGLB_ASPTN	sp|Q0C7K7|RGLB_ASPTN	3.05e-18	126	565	153	660	Probable rhamnogalacturonate lyase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999770	CS pos: 17-18. Pr: 0.9843

TMHMM  Annotations     

There is no transmembrane helices in KAA8913077.1.